Uncanny HIV inserts of Pradhan and Perez - sars2.net

First published 2024-05-27 UTC, last modified 2026-04-11 UTC

Contents

Pradhan et al.'s HIV inserts

E-values of Pradhan's matches

I'm referring to the authors of the Pradhan et al. paper simply as Pradhan for the sake of convenience, even though the paper indicated that there were three authors who had an equal contribution to the paper, who were Prashant Pradhan, Ashutosh Kumar Pandey, and Akhilesh Mishra. [https://www.researchgate.net/publication/338957445_Uncanny_similarity_of_unique_inserts_in_the_2019-nCoV_spike_protein_to_HIV-1_gp120_and_Gag]

Pradhan did a pairwise alignment of the spike protein of SARS-CoV-2 against SARS-CoV, and he identified 4 regions where SARS-CoV had gaps in the alignment, which he interpreted to be inserts in SARS-CoV-2 relative to SARS-CoV:

When Pradhan did BLAST searches for the so-called inserts and the surrounding amino acids, he found that for example the last 6 aa of the first 7 aa insert had a perfect match to an HIV sequence from Thailand, and the last 2 aa of the second insert along with the next 4 aa had a perfect match to an HIV sequence from Kenya:

However all of the matches were either so short or they had so many mismatches that the matches were highly likely to occur by chance. In BLAST, the E-value indicates how many similarly close or closer matches are expected to occur by chance for the given combination of query sequence and target sequences, but Pradhan deceptively did not report the E-values of his matches anywhere.

I went to the web interface for protein BLAST: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp. I set query to TNGTKR, which was the match Pradhan found to the first so-called insert, I set organism to "Viruses (taxid:10239)", I clicked "Add organism", and I set the second organism to "Betacoronavirus pandemicum (taxid:3418604)" and I clicked the exclude checkbox next to it. Then under "Algorithm parameters" I increased "Max target sequences" to 1000, and I clicked "BLAST". Pradhan's match occured in a set of 10 similar sequences from Thailand whose accesions start with AFU28. The E-values of the matches were 428, which means that about 428 similarly close or closer matches were expected to occur by chance:

There was a total of 310 sequences with a perfect 6 aa match to the query TNGTKR, so the E-value of 428 was fairly close to the actual number of perfect matches. The perfect matches occurred among species like "Acute bee paralysis virus", "Cnidium virus 2", "Echovirus E11", "Barkedji virus", "Wild boar ephemerovirus", "Rotavirus A", "phage csAssE-Sib", "environmental Halophage eHP-31", "bajarodmic virus 944", "Wuhan House Fly Virus 1", "Vibrio phage PERU2", and so on. Pradhan's matches to the other so-called inserts also occurred among many other species of viruses besides HIV.

When I did similar BLAST searches for Pradhan's matches to the other so-called inserts, all of the matches had an E-value above 100:

Insert SARS-CoV-2 HIV E-value Results with same or lower E-value
1 TNGTKR TNGTKR 428 310
2 HKNNKS HKNNKS 212 8
3 RSYL---TPGDSSSG RSYLFNETRGNSSSG 281 236
4 QTNS-----------PRRA QTNSSILMQRSNFKGPRRA 705 75

In March 2026 when I did my BLAST searches, the nr protein BLAST database was about 4 times bigger than in January 2020 when Pradhan did his BLAST searches, so my E-values were also about 4 times bigger than the E-values in January 2020. However when Pradhan identified the matches to the so-called inserts, he searched for the inserts and an unspecified number of surrounding residues from either side of the insert, so there were multiple possible sequences that could match the region around each insert. So in reality his E-values were likely even higher than the values in my table above (unless for example he performed separate searches for multiple different 6 aa segments around the second insert, and not for a single longer segment that consisted of the second insert and an arbitrary number of surrounding residues on either side, but even in that case, the total E-value of all separate searches added together would likely be more than 4 times higher than the value for a single 6 aa search).

The nr database contains a large number of sequences from widely studied species of viruses like SARS-CoV-2, HIV-1, and influenza A. But in order to restrict a BLAST search to a database that only has one or a few representative samples for each species of virus, I searched for TNGTKR in the refseq_protein database instead, so that I restricted the organism to viruses. I got an E-value of about 36 for the perfect matches, so even within a fairly small pool of proteins from virus refseqs, the E-values for perfect matches to the 6 aa segment were still very high:

The results for my query above didn't include any HIV sequences, because the envelope protein of the HIV-1 refseq matches only 2 of 6 residues of TNGTKR at the spot where Pradhan's HIV sequences from Thailand match TNGTKR.

Multiple sequence alignments of regions around inserts

Pradhan identified the locations of the so-called inserts by doing a pairwise alignment of SARS-CoV-2 against SARS-CoV, so his pairwise alignment didn't make it clear if the regions with gaps were inserts in SARS-CoV-2 or deletions in SARS-CoV. He should've done a multiple sequence alignment of a larger set of sarbecoviruses instead, which would've had the additional benefit that it would've inserted the gaps at more accurate positions that would've been informed by the overall phylogeny of sarbecoviruses.

The first so-called insert in Pradhan's alignment was GTNGTKR, which actually looks more like a deletion in SARS-CoV than an insertion in SARS-CoV-2, because for example the Bulgarian virus BM48 has NGKQR at the same spot. The TKR at the end of the first so-called insert is also included in ZC45 and RpYN06:

Pradhan's second insert was YYHK, and when he searched for the insert and surrounding residues on BLAST, he found an HIV sequence from Kenya that matched the last 2 residues of the insert and the next 4 residues (HKNNKS). However the YYHKNNK without the K in the middle is also included in ZC45 and ZXC21, which had already been published in January 2020 when Pradhan wrote his paper, so a major omission in his paper was that he didn't say anything about ZC45 or ZXC21 in the paper:

From the alignment above, you can also see that relative to the original SARS-CoV, SARS-CoV-2 has the deletion SK and the insertion MESEFR, but the YYHK doesn't even look like an insert in my alignment. Trevor Bedford also pointed out that the YYHK didn't look like an insert relative to other sarbecoviruses, but from his alignment it looks like SARS-CoV-2 has the insertion SEFR relative to SARS-CoV-: [https://x.com/trvrb/status/1223667730911354880]

The third insert Pradhan highlighted in his alignment consisted of the 3 amino acids SSG, even though a bit before it there was another insert of 3 amino acids that he ignored in his paper, which I'm calling insert 2.5. In my alignment below, the gaps were not placed at the spot of SSG but a few residues earlier, so that inserts 2.5 and 3 were combined into a single 6 aa insert SYLTPG:

I used code like this to make the colorized amino acid alignments:

# download whole genome sequences of sarbecoviruses
curl -sL sars2.net/f/sarbe.fa.xz|xz -dc>sarbe.fa

# efetch multiple sequences with accessions from STDIN
emu()(curl -sd "id=$(paste -sd,)" "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=${1:-nuccore}&rettype=${2:-fasta}&retmode=$3")

# download spike protein sequences of sarbecoviruses and rename them to have same the defline as the whole genome sequences
seqkit seq -ni sarbe.fa|emu '' fasta_cds_aa|seqkit grep -nrp gene=S,spike,surface|sed 's/_prot_.*//;s/lcl|//'|seqkit fx2tab|awk -F\\t 'NR==FNR{a[$1]=$2;next}{print">"$1" "a[$1]"\n"$2}' <(seqkit seq -n sarbe.fa|sed $'s/ /\t/') ->spike.aa

# make a TSV matrix for percentage identity between spike protein sequences
aln()(\mafft --thread 3 --quiet "${@--}")
curl -Ls sars2.net/f/pid.cpp>pid.cpp;g++ pid.cpp -O3 -o pid
seqkit replace -isp '[^X]' -r '' spike.aa|seqkit seq -m 5|seqkit seq -ni|seqkit grep -vf- spike.aa|aln|./pid>spike.pid

# thin out a TSV percentage identity matrix by removing rows with over n% identity to any previous row (default 99%)
thin()(awk -F\\t 'NR>1{for(i=2;i<NR;i++)if($i>x)next;print$1}' x="${1-99}" "${@:2}")

# print color scheme
aacolor()(printf %s\\n A:242:121:121 C:242:182:121 D:242:242:121 G:182:242:121 F:121:242:151 E:121:242:222 T:121:182:242 I:121:121:242 K:182:121:242 L:242:121:242 M:255:191:191 N:255:223:191 P:255:255:191 Q:223:255:191 R:191:255:207 S:191:255:244 H:191:223:255 V:191:191:255 W:223:191:255 Y:255:191:255 -:140:140:140 X:255:255:255 \*:255:255:255|tr : \ )

# display alignment with colorized amino acids
seqcol()(seqkit seq -u|seqkit fx2tab|gawk -F\\t 'NR==FNR{a[$1]=$2;next}{name[FNR]=$1;split($2,z,"");for(i in z)seq[FNR][i]=z[i];if(length($1)>max1)max1=length($1);if(length($2)>max2)max2=length($2)}END{for(i=1;i<=max2;i+=width){printf("%"(max1+1)"s","");for(pos=i;pos<i+width&&pos<=max2;pos+=10)printf(pos-i>width-10?"%s":"%-10s",pos);print"";for(j in seq){printf("%"max1"s ",name[j]);for(k=i;k<=max2&&k<i+width;k++)printf("%s","\033[38;2;0;0;0m\033[48;2;"a[seq[j][k]]"m"seq[j][k]"\033[0m");print""}}}' "width=${1-60}" <(aacolor|sed $'s/ /\t/;s/ /;/g') -)

# print an alignment of selected viruses
thin 92 <spike.pid|cut -d\  -f1|seqkit grep -f- spike.aa|seqkit grep -nrvp 'SARS coronavirus'|cat - <(seqkit grep -nrip db159,hu-1,tor2,zc45,rp3\\b,rs7896,banal-20-52,ratg,lyra11,btsy2,shc014,wiv1\\b,gx_p2v,gx-p1e spike.aa)|seqkit rmdup -s|aln --reorder -|cut -d, -f1|sed 's/>[^ ]*/>/;s/ ORF.*//;s/ surface .*//;s/Severe acute respiratory syndrome/SARS/;s/Khosta-2 strain //;s/ isolate / /;s/ strain / /;s/Bat SARS-like coronavirus //;s/Betacoronavirus sp. //;s/ RNA$//'|seqcol

Fourth insert

The fourth insert Pradhan highlighted was PRRA, and when he searched for the insert and surrounding residues on BLAST, he found a sequence of HIV that matched PRRA and the 4 residues before it but that had 11 other residues in between.

The match only appeared in a single protein sequence of HIV from India, but the match didn't occur in any of the other approximately 10,000 HIV sequences in the nr protein database.

You can see the total number of HIV sequences in the database if you go here: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome. Then enter QTNSPRRA to the big text box, switch the database to nr, set the organism to "Human immunodeficiency virus", and click BLAST. Then if you click "Search Summary", it shows the total number of sequences that matched the species filter, which was 13,330 in 2026:

In the region where the Indian sequence contains QTNS followed by 11 residues and then PRRA, the HXB2 reference genome of HIV contains QVTNS followed by 12 residues and then QRKI:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=protein&rettype=fasta&id=AKR75206,NP_057850'|mafft --clustalout -
[...]
AKR75206.1  RVLAEAMSQ-TNS-SILMQRSNFKGPRRAVKCFNCGREGHIAKNCRAPRKKGCWKCGKEG
NP_057850.1 RVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
            ********* *** :*:***.**:. *: *******:*** *:*****************
                    ^^^^^^^^^^^^^^^^^^^^^
                    Pradhan's match to insert 4
[...]

So if SARS-CoV-2 was genetically engineered to add HIV inserts into the genome, then how did the engineers know to borrow the PRRA insert from some obscure Indian sequence of HIV, where the PRRA didn't even appear directly after QTNS but had 11 other residues in between?

Why Pradhan's inserts match the hypervariable loops of HIV

Pradhan's matches to the first two so-called inserts were both 6 aa long. In the code below I generated 1000 random sequences of 6 amino acids, and I searched for them against the protein coding sequences of the reference genome of HIV-1. The best match had 0 mismatches in 0 cases, 1 mismatch in 7 cases, 2 mismatches in 216 cases, 3 mismatches in 765 cases, and 4 mismatches in 12 cases:

$ tr -dc ACDEFGHIKLMNPQRSTVWY</dev/random|head -c$[6*1000]|sed 's/....../&\n/g'|awk '{print">"NR}1'>random.fa
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=NC_001802'>hiv1.aa
$ <random.fa seqkit locate -m0 -f- hiv1.aa|awk 'NR>1{a[$2]}END{print length(a)}'
0
$ <random.fa seqkit locate -m1 -f- hiv1.aa|awk 'NR>1{a[$2]}END{print length(a)}'
7
$ <random.fa seqkit locate -m2 -f- hiv1.aa|awk 'NR>1{a[$2]}END{print length(a)}'
223 # 223-7 = 216
$ <random.fa seqkit locate -m3 -f- hiv1.aa|awk 'NR>1{a[$2]}END{print length(a)}'
988 # 988-223 = 765
$ <random.fa seqkit locate -m4 -f- hiv1.aa|awk 'NR>1{a[$2]}END{print length(a)}'
1000 # 1000-988 = 12

So most commonly the best match had 3 out of 6 matching amino acids. In order to turn it to a 6 out of 6 aa match, you need to have 3 aa changes within a 6 aa segment from the reference genome of HIV. The reference genome was collected in 1984, but in the more stable regions of the genome, even samples from the 2020s still have fairly long stretches of amino acids that are identical to the reference genome. But in the hypervariable regions, it's common to have multiple amino acid changes within a 6 aa segment. So if you generate a bunch of random 6 aa segments, and you pick the segments that have nonzero perfect matches within a set of HIV protein sequences, the segments are likely to match the hypervariable regions.

I downloaded a set of 10,733 HIV-1 envelope protein sequences by going here, changing "DNA/Protein" to "Protein", clicking "Get Alignment", and clicking "Download this alignment": https://www.hiv.lanl.gov/content/sequence/NEWALIGN/align.html.

The set of envelope protein sequences included a total of 14,183 perfect matches to a set of 100,000 random 6 aa sequences:

$ seqkit seq -g HIV1_ALL_2022_env_PRO.fasta|seqkit replace -sp\# -rX>HIV1_ALL_2022_env_PRO.ungap
$ tr -dc ACDEFGHIKLMNPQRSTVWY</dev/random|head -c$[6*100000]|sed 's/....../&\n/g'|awk '{print">"NR}1'>random100k.fa
$ seqkit locate -Pf random100k.fa HIV1_ALL_2022_env_PRO.ungap>matches100k
$ sed 1d matches100k|wc -l
14183

The matches occurred in 1,013 unique segments out of the 100,000 random 6 aa segments:

$ sed 1d matches100k|cut -f7|sort -u|wc -l
1013

I kept one random match for each unique segment, and I converted the starting position of each match to HXB2 coordinates:

sed 1d matches100k|shuf|awk '!a[$7]++'|cut -f1,5|
while read l m;do seqkit grep -p$l HIV1_ALL_2022_env_PRO.fasta|seqkit seq -s|
awk -F '' '{for(i=1;i<=NF;i++){gaps+=$i=="-";if(i-gaps==x){print i;exit}}}' x=$m;done>alnpos

seqkit head -n1 HIV1_ALL_2022_env_PRO.fasta|seqkit seq -s|cat - alnpos|
awk -F '' 'NR==1{for(i=1;i<=NF;i++){pos+=$i!="-";a[i]=pos};next}{print a[$0]}'>hxbpos

Then when I made a histogram of the starting positions, you can see that there are peaks in the number of matches over the variable loops (even though I don't know why there's one peak after the third loop but not over the third loop):

p=fread("hxbpos")[,.(y=.N),.(x=V1%/%10*10)]
p=rbind(p,list(0:85*10,0))[rowid(x)==1][order(x)]

loops=fread("loop,start,end
V1,131,157
V2,158,196
V3,296,331
V4,385,418
V5,460,469")

xend=max(p$x);ybreak=pretty(c(0,max(p$y)),7);yend=max(ybreak);xbreak=seq(1,xend,100)

ggplot(p)+
geom_vline(xintercept=xbreak,color="gray90",linewidth=.4)+
geom_hline(yintercept=c(0,yend),color="gray75",linewidth=.4,lineend="square")+
geom_vline(xintercept=c(1,xend),color="gray75",linewidth=.4,lineend="square")+
geom_rect(data=loops,aes(xmin=start,xmax=end,ymin=0,ymax=yend),fill=alpha("red",.3))+
geom_rect(aes(xmin=x,xmax=x+10,ymin=0,ymax=y),fill="black")+
geom_text(data=loops,aes(x=start+(end-start)/2,y=yend*.96,label=loop),color="#aa0000",size=3.5)+
labs(title="Count of matches to 10,000 random 6 aa segments per 10 aa block of HIV envelope protein")+
scale_x_continuous(limits=c(1,xend),breaks=xbreak)+
scale_y_continuous(limits=c(0,yend),breaks=ybreak)+
coord_cartesian(clip="off",expand=F)+
theme(axis.text=element_text(size=10,color="black"),
  axis.ticks=element_line(size=.4,color="gray75",linewidth=.4),
  axis.ticks.length.x=unit(0,"pt"),
  axis.ticks.length.y=unit(4,"pt"),
  axis.title=element_blank(),
  panel.grid=element_blank(),
  panel.background=element_blank(),
  plot.subtitle=element_text(size=10,margin=margin(,,4)),
  plot.title=element_text(size=11,hjust=.5,face=2,margin=margin(,,4)))
ggsave("1.png",width=7.1,height=3.4,dpi=300*4)

system("mogrify -trim 1.png;magick 1.png \\( -size `identify -format %w 1.png`x -font Arial -interline-spacing -3 -pointsize $[43*4] caption:'First exact matches were located to 10,000 random 6 aa segments within a set of 10,733 HIV envelope protein sequences downloaded from here: hiv.lanl.gov/content/sequence/NEWALIGN/align.html. One match for each unique 6 aa segment was selected at random. The starting positions of the matches were then converted to HXB2 coordinates.' -splice x$[16*4] \\) -append -trim -resize 25% -bordercolor white -border 26 -dither none -colors 256 1.png")

Number of 6 aa matches between SARS-CoV-2 and HIV-1

Pradhan's matches to the first two so-called inserts are both 6 aa long. There are 9,648 unique 6 aa segments of the coding sequences of Wuhan-Hu-1. When I searched for all of them against the same set of 10,733 env protein sequences I looked at in the previous section, I got a perfect match for 204 segments, which is about 2% of all segments, even though I only looked at a fairly small set of env protein sequences and not all proteins of HIV:

$ curl -s 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nucleotide&rettype=fasta_cds_aa&id=MN908947'>sars2.aa
$ seqkit sliding -W6 -s1 sars2.aa|seqkit rmdup -s|seqkit locate -Pf- HIV1_ALL_2022_env_PRO.ungap>temp
$ sed 1d temp|awk '!a[$3]++'|wc -l
204

Next I searched GenBank for protein sequences that matched the query 0:2019[dp] "Human immunodeficiency virus 1"[porgn:__txid11676]. [https://www.ncbi.nlm.nih.gov/protein/?term=0%3A2019%5Bdp%5D+%22Human+immunodeficiency+virus+1%22%5Bporgn%3A%5f%5ftxid11676%5D] There were a total of 1,147,397 results, which consisted of a set of 746,655 unique protein sequences, which is similar to the set of HIV protein sequences that were included in the nr BLAST database at the time Pradhan did his BLAST searches in January 2020. Downloading the results with efetch failed, so I downloaded the results from the web GUI by selecting "Send to:", selecting "File", and changing "Format" to "FASTA". There were now perfect matches for 677 out of 9,648 of the 6 aa segments:

$ seqkit sliding -W6 -s1 sars2.aa|seqkit rmdup -s|seqkit locate -Pf- Downloads/sequence.fasta>temp3
$ sed 1d temp3|awk '!a[$3]++'|wc -l
677

So if a 6 aa match counts as an "HIV insert", then there are not only HIV inserts at the spots of the genome of SARS-CoV-2 that look like inserts relative to SARS-CoV, but there are HIV inserts throughout the genome.

Matches to sequences from HIV and influenza databases

The env protein of HIV is divided into the gp120 and gp41 polyproteins, but Pradhan et al.'s first insert matched the gp120 part. I downloaded 125,046 gp120 sequences from the HIV sequence database of the Los Alamos National Laboratory: https://www.hiv.lanl.gov/components/sequence/HIV/search/search.html. None of them matched the full GTNGTKR insert, but there were 15 sequences that matched the first 6 aa and there were 12 sequences which matched the last 6 aa, and the matches were at 3 different spots:

$ seqkit stat HIV-1_env.fasta|column -t
file             format  type     num_seqs  sum_len      min_len  avg_len  max_len
HIV-1_env.fasta  FASTA   Protein  125,046   105,184,828  479      841.2    1,469
$ seqkit locate -p GTNGTK HIV-1_env.fasta|cut -f1,5-7|column -t
seqID                                            start  end  matched
C.IN.-.VB49.EF694035                             135    140  GTNGTK
C.ZA.2009.CAP177_39mo_30.KC833437                452    457  GTNGTK
C.ZA.2009.CAP177_4260_186wpi_plasma_12.MK205618  452    457  GTNGTK
C.ZA.2009.CAP177_4260_186wpi_cvl_73.MK205633     452    457  GTNGTK
B.US.1990.1580m.11a.MT861903                     136    141  GTNGTK
B.US.1990.1580m.13s.MT861906                     136    141  GTNGTK
B.US.1990.1580m.15.MT861908                      136    141  GTNGTK
B.US.1990.1580m.16a.MT861910                     136    141  GTNGTK
B.US.1990.1580m.17.MT861911                      136    141  GTNGTK
B.US.1990.1580m.18.MT861913                      136    141  GTNGTK
B.US.1990.1580m.22.MT861919                      136    141  GTNGTK
B.US.1990.1580m.3a.MT861922                      136    141  GTNGTK
B.US.1990.1580m.5.MT861925                       136    141  GTNGTK
B.US.1990.1580m.7.MT861927                       136    141  GTNGTK
A1CD.TZ.2012.30196v23_env12.OM825465             460    465  GTNGTK
$ seqkit locate -p TNGTKR HIV-1_env.fasta|cut -f1,5-7|column -t
seqID                                start  end  matched
01_AE.TH.2006.AA042a12R.JX447199     364    369  TNGTKR
01_AE.TH.2006.AA042a13R.JX447200     399    404  TNGTKR
01_AE.TH.2006.AA042a09R.JX447201     398    403  TNGTKR
01_AE.TH.2006.AA042a08R.JX447202     398    403  TNGTKR
01_AE.TH.2006.AA042a10R.JX447203     404    409  TNGTKR
01_AE.TH.2006.AA042a11R.JX447204     404    409  TNGTKR
01_AE.TH.2006.AA042a02R.JX447205     398    403  TNGTKR
01_AE.TH.2006.AA042a05R.JX447206     398    403  TNGTKR
01_AE.TH.2006.AA042a07R.JX447207     398    403  TNGTKR
01_AE.TH.2006.AA042a03R.JX447208     399    404  TNGTKR
01_AE.TH.2006.AA042a06R.JX447209     404    409  TNGTKR
01_AE.TH.2007.AA042d_ENV24.MZ347079  408    413  TNGTKR

So again it's not that unusual that 29 out of over a 100,000 sequences would happen to match 6 out of 7 aa. The reason why all four of Pradhan's inserts happened to match HIV and not some other virus might simply be that BLAST has a very large number of HIV sequences relative to other viruses.

Pradhan's second so-called insert matches the last 2 aa of the YYHK insert here and the next 4 aa:

But there's a total of 7 possible 6 aa segments which include at least 2 aa of the 4 aa insert, so again it's not that surprising that one of them would happen to match one out of the approximately 10,000 HIV protein sequences in the nr database. The gp120 sequences I downloaded had a perfect match for only one out of the 7 segments:

$ x=FLGVYYHKNNKS;for i in {0..6};do seqkit locate -ip ${x:i:6} HIV-1_env.fasta;done
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
seqID   patternName pattern strand  start   end matched
G.KE.2006.06KE275457V6.KT022379 HKNNKS  hknnks  +   462 467 hknnks

I also tried downloading all protein sequences of influenza A from the NCBI's influenza virus database. I simply kept the default settings here and clicked "add query": https://www.ncbi.nlm.nih.gov/genomes/FLU/Database/nph-select.cgi#mainform. There were a bit over a million sequences:

$ seqkit stat influenzamega.fa
file              format  type      num_seqs      sum_len  min_len  avg_len  max_len
influenzamega.fa  FASTA   Protein  1,234,340  497,828,616        1    403.3      775

The spike protein of Wuhan-Hu-1 is 1273 aa long so it has 1268 possible 6 aa subsegments. However 269 of them had an exact match to one or more of the protein sequences of influenza A:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=MN908947'|seqkit grep -nrp gene=S>sars2spike.aa
$ seqkit seq -s sars2spike.aa|awk '{for(i=1;i<length-5;i++)print substr($0,i,6)}'>kmer
$ grep -f kmer <(seqkit seq -s influenzamega.fa)>temp
$ for x in `<kmer`;do grep -m1 $l temp;done|wc -l
269

And in a FASTA file with 125,046 gp120 sequences of HIV, 53 out of 1268 6-mers had a perfect match (but the number would've been bigger if I was looking at all proteins of HIV and not just gp120):

$ grep -fkmer <(seqkit seq -s HIV-1_env.fasta)>temp2
$ for x in `<kmer`;do grep -m1 $x temp2;done|wc -l
53

Arkmedic's BLAST searches for Pradhan et al.'s inserts

Arkmedic did a BLAST search for the nucleotide sequence of Pradhan's first insert, but he used the coding sequence of the insert in SARS2 and not HIV. He restricted the search to viruses published in 2019 or earlier, so many of the top matches were sequences of HIV: [https://www.arkmedic.info/p/absolute-proof-the-gp-120-sequences]

However his top matches got only 83% query coverage because they only matched 15 out of 18 bases of the query, similar to my matches here:

The first match above was missing the first 3 bases of the query and the second match was missing the first base, but both matches were still in frame so that the first match coded for 5 out of 6 aa of TNGTKR and the second match coded for 4 out of 6 aa:

$ emu()(curl -sd "id=$(paste -sd,)" "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=${1:-nuccore}&rettype=${2:-fasta}&retmode=$3")
$ emu protein fasta_cds_na<<<AVN55366|seqkit translate|seqkit subseq -r 400:409
>lcl|MH012801.1_cds_AVN55366.1_1 [gene=env] [protein=envelope glycoprotein] [protein_id=AVN55366.1] [location=1..2577] [gbkey=CDS]
WENGTKRSNE
$ emu '' fasta_cds_na<<<JX071072|seqkit translate|seqkit subseq -r 259:266
>lcl|JX071072.1_cds_AFV81607.1_1 [gene=env] [protein=envelope glycoprotein] [protein_id=AFV81607.1] [location=<1..>1116] [gbkey=CDS]
NPNGTKIY

The main text of Pradhan's paper doesn't include the accession numbers of the HIV sequences which matched his so-called inserts, but you have to dig the accession numbers up from the supplementary Excel file, which was only posted at bioRxiv but not ResearchGate: https://www.biorxiv.org/content/10.1101/2020.01.30.927871v1.supplementary-material?versioned=true. The supplementary Excel file shows that the first insert was matched by 10 different sequences from Thailand:

country accession subtype insert
Thailand AFU28737.1 CRF01_AE Insert 1
Thailand AFU28711.1 CRF01_AE Insert 1
Thailand AFU28717.1 CRF01_AE Insert 1
Thailand AFU28733.1 CRF01_AE Insert 1
Thailand AFU28693.1 CRF01_AE Insert 1
Thailand AFU28721.1 CRF01_AE Insert 1
Thailand AFU28699.1 CRF01_AE Insert 1
Thailand AFU28729.1 CRF01_AE Insert 1
Thailand AFU28705.1 CRF01_AE Insert 1
Thailand AFU28725.1 CRF01_AE Insert 1
Kenya ALB06757.1 G Insert 2
India ACL98861.1 C Insert 3
India ACL98864.1 C Insert 3
India ACL98860.1 C Insert 3
India ACL98859.1 C Insert 3
India AKR75206.1 C Insert 4

However in all Thai sequences the first insert was coded by ACA AAT GGA ACC AAG AGG, so it's actually 3 bases different from the nucleotide sequence in Wuhan-Hu-1 that was used by Arkmedic (ACC AAT GGT ACT AAG AGG):

$ emu()(curl -sd "id=$(paste -sd,)" "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=${1:-nuccore}&rettype=${2:-fasta}&retmode=$3")
$ emu protein fasta_cds_na<<<AFU28737,AFU28711,AFU28717,AFU28733,AFU28693,AFU28721,AFU28699,AFU28729,AFU28705,AFU28725 >insert1.fa
$ seqkit translate insert1.fa|seqkit locate -p TNGTKR|sed 1d|cut -f1,5|while read l m;do seqkit grep -p $l insert1.fa|seqkit subseq -r $[m*3-2]:$[m*3-2+17];done|seqkit seq -s|sort -u|sed 's/.../& /g'
ACA AAT GGA ACC AAG AGG

There were about 3.2 million results at GenBank when I searched for 0:2019[dp] viruses[organism], but about 0.9 million or about 27% of all results were classified under HIV-1. [https://www.ncbi.nlm.nih.gov/nuccore/?term=0%3A2019%5Bdp%5D+viruses%5Borganism%5D] So the reason why many of Arkmedic's top hits at BLAST were sequences of HIV-1 might be because before 2020 HIV-1 was probably the species of virus with the most sequences at GenBank:

Arkmedic also wrote that he didn't find any 100% match when he searched for the nucleotide sequence of Pradhan's second insert on BLAST, but that's because he again used the nucleotide sequence in Wuhan-Hu-1 (CAC AAA AAC AAC AAA AGT), which is 3 bases different from Pradhan's HIV sequences:

$ emu protein fasta_cds_na<<<ALB06757 >insert2.fa
$ x=$(seqkit translate insert2.fa|seqkit locate -p HKNNKS|sed 1d|cut -f5);seqkit subseq -r $[x*3-2]:$[(x+5)*3] insert2.fa|seqkit seq -s|sed 's/.../& /g'
CAT AAA AAT AAT AAA AGT

When I did a BLAST search for the nucleotide sequence in HIV, it had 18/18 matching bases only with Pradhan's Kenyan HIV-1 sequence and with some other random virus where the match was on the minus strand (but in the screenshot below the other results with 100% identity and 100% query coverage were noncontiguous matches where the match was split into two different segments, as you can see from the max score being lower than on the first two rows):

Arkmedic also pointed out that he found no matches for Pradhan's third insert on BLAST, but that's because he searched for the region around the insert in SARS-CoV-2 and not HIV (RSYLTPGDSSSG and not RTYLFNETRGNSSSG). The nucleotide sequence of the version in HIV is found in all 4 HIV sequences that were listed in Pradhan's supplementary Excel file:

$ emu protein fasta_cds_na<<<ACL98861,ACL98864,ACL98860,ACL98859 >insert3.fa
$ x=RTYLFNETRGNSSSG;seqkit translate insert3.fa|seqkit locate -p $x|sed 1d|cut -f1,5|while read l m;do seqkit grep -p $l insert3.fa|seqkit subseq -r $[m*3-2]:$[(m+${#x})*3];done|seqkit seq -s|sort -u|sed 's/.../& /g'
AGG ACA TAC CTG TTT AAT GAG ACA AGA GGT AAT TCA AGC TCA GGT AAT

Arkmedic wrote: "TLDR: In order to get the 3 inserts of Gp-120 to exist in SARS-Cov-2, the genomic sequences that coded for them had to have got there by recombination from another organism or in a lab. Because they don't exist anywhere in nature it is not possible to have come from another organism."

However as I showed earlier, Pradhan's first insert actually looks like a deletion in SARS1 and not an insertion in SARS2. And Pradhan's second and third inserts were placed at the wrong spot because he only did a pairwise alignment of SARS1 and SARS2 and he didn't include more sarbecoviruses in his alignment.

Arkmedic was also wrong that the inserts "don't exist anywhere in nature", because the first two so-called inserts are only 6 aa long, so if you do a BLAST search for the nucleotide sequences of the inserts in Wuhan-Hu-1, they get perfect matches to many organisms but just not to virus sequences published before 2020, like for example this shows that the second insert has perfect matches to mollusks, otters, fish, and so on:

Arkmedic wrote: "I mean, sure, the old virus can undergo some mutations (GATTTCA...) but these are evolutionarily very slow and can result in deletions and changes. In order to get inserts for these to happen by chance is so rare that it would take millions of years to develop functional inserts by chance so you really need a genome donor." However for example the nucleotide sequence of the second insert is CACAAAAACAACAAAAGT in Wuhan-Hu-1, which is identical in RaTG13, differs by one base in BANAL-52 and BtSY2, and differs by two bases in Rp22DB159. And even if you consider all sequences released since 2020 to be fake, even in ZC45 which was published in 2018, the region of the so-called insert differs by 3 nucleotide changes and 3 gaps:

Similarly the nucleotide sequence of the first insert TNGTKR differs by 2 bases in RaTG13, 3 bases in BANAL-52, BtSY2, and Rp22DB159, and 7 bases in ZC45 (but it's located within a variable region of the genome that is expected to be mutating fast):

Matches to env in LANL's HIV subtype reference

From the HIV sequence database of the Los Alamos National Laboratory, you can download a FASTA file which contains 2-5 sequences from different subtypes of HIV-1 along with 27 chimpanzee and gorilla sequences of SIV that are similar to HIV-1. Set "Alignment type" to "Web (all complete sequences)", set "DNA/Protein" to "Protein", and click "Get alignment": https://www.hiv.lanl.gov/content/sequence/NEWALIGN/align.html. You can keep region as "env" to download only the envelope protein, which covers about 20% of the genome of HIV-1.

The 2023 edition of LANL's subtype reference has a total of 555 sequences, but zero of them have a perfect match to Pradhan's first motif TNGTKR. Two sequences have one mismatch, 215 have 2 mismatches, and the rest have 3 mismatches:

$ wget sars2.net/f/HIV1_REF_2023_env_DNA.fasta
$ x=TNGTKR;for((i=0;i<=${#x};i++));do seqkit seq -g HIV1_REF_2023_env_PRO.fasta|seqkit replace -sp \# -r X|seqkit locate -iPp $x -m$i|sed 1d|awk '!a[$1]++'|echo "$i `wc -l`";done
0 0
1 2
2 215
3 555
4 555
5 555
6 555

For the second motif HKNNKS, there's zero perfect matches and only sequence with a single mismatch:

$ x=HKNNKS;for((i=0;i<=${#x};i++));do seqkit seq -g HIV1_REF_2023_env_PRO.fasta|seqkit replace -sp \# -r X|seqkit locate -iPp $x -m$i|sed 1d|awk '!a[$1]++'|echo "$i `wc -l`";done
0 0
1 1
2 41
3 551
4 555
5 555
6 555

All of the matches with one mismatch were located in the first half of gp120:

$ seqkit seq -g HIV1_REF_2023_env_PRO.fasta|seqkit replace -sp\# -rX|seqkit locate -ip TNGTKR -m1|cut -f1,3,5-|column -t
seqID                               pattern  start  end  matched
Ref.H.GB.00.00GBAC4001.FJ711703     tngtkr   190    195  tngtnr
Ref.L.CD.01.L_CG_0018a_01.MN271384  tngtkr   132    137  tngttr
$ seqkit seq -g HIV1_REF_2023_env_PRO.fasta|seqkit replace -sp\# -rX|seqkit locate -ip HKNNKS -m1|cut -f1,3,5-|column -t
seqID                               pattern  start  end  matched
Ref.101_01B.CN.13.YNKM250.MK158946  hknnks   366    371  hfnnks

The two matches to TNGTKR were both located within variable loops but the match to HKNNKS wasn't:

seqkit grep -nrp FJ711703,MN271384,YNKM250,HXB2 HIV1_REF_2023_env_PRO.fasta|seqkit replace -p'^Ref\.(.*)\..*?$' -r\$1|mafft --quiet -|seqkit fx2tab|gawk -F\\t 'ARGIND==1{a[$1]=$2}ARGIND==2{for(i=$2;i<=$3;i++)loop[i]=$1}ARGIND==3{if($1~/HXB2/){gap=0;split($2,z,"");for(i in z){if(z[i]=="-")gap++;gaps[i]=gap}}name[FNR]=$1;split($2,z,"");for(i in z)seq[FNR][i]=z[i];if(length($1)>max1)max1=length($1);if(length($2)>max2)max2=length($2)}END{width=60;for(i=1;i<=max2;i+=width){print"";printf("%*s",max1+1,"");for(pos=i;pos<i+width&&pos<=max2;pos+=10)printf(pos-i>width-10?"%s":"%-10s",pos-gaps[pos]);print"";printf("%*s",max1+1,"");for(pos=i;pos<i+width;pos++){l=loop[pos-gaps[pos]];printf"%s",l?l:" "};print"";for(j in seq){printf("%"max1"s ",name[j]);for(k=i;k<=max2&&k<i+width;k++)printf("%s","\033[38;2;0;0;0m\033[48;2;"a[seq[j][k]in a?seq[j][k]:"X"]"m"seq[j][k]"\033[0m");print""}}}' <(aacolor|sed $'s/ /\t/;s/ /;/g') <(printf %s\\n 1:131:157 2:158:196 3:296:331 4:385:418 5:460:469|tr : \\t) -

The numbers in the image above show the position in HXB2. I used these as the coordinates of the variable loops in the env protein of HXB2:

loop start end
V1   131   157
V2   158   196
V3   296   331
V4   385   418
V5   460   469

Are Pradhan's inserts involved in entry to CD4 T helper cells?

Tony VanDongen posted this tweet: [https://x.com/tony_vandongen/status/1887707580148941305]

Brian Gadd posted this reply: "AFAIK there is no evidence that these sequences are necessary or sufficient for CD4 binding; they are absent from most gp120 sequences, no two homology sequences are found in the same molecule of gp120, they barely overlap with the CD4 binding site & not at the most important contact points." [https://x.com/Brian_Gadd/status/1887724003604746578] He also replied: "Brunetti et al. did look at spike-CD4 interaction and their binding data suggests that this interaction is almost exclusively mediated by the RBD, not the NTD: https://elifesciences.org/articles/84790." Another user responded: "CD209 (DC-SIGN) is a lectin that binds HIV gp120 and modulates CD4+ T-cell infection. Lectin-gp120 interactions impact HIV entry - critical for viral transmission and immune evasion." But Gadd answered: "Yes. And Amraei et al. found that L-SIGN and DC-SIGN do indeed bind to spike, and that this interaction is mediated by the RBD: https://pubs.acs.org/doi/10.1021/acscentsci.0c01537."

Perez and Montagnier's paper about BLAST matches to HIV

In April 2020 Jean-Claude Perez and Luc Montagnier published a preprint at OSF titled "COVID-19, SARS and Bats Coronaviruses Genomes Unexpected Exogenous RNA Sequences". [https://osf.io/preprints/osf/d9e5g_v1] A slightly revised version of the preprint was published in May 2020 at ResearchGate. [https://www.researchgate.net/publication/341756383_COVID-19_SARS_and_Bats_Coronaviruses_Genomes_Unexpected_Exogenous_RNA_Sequences] The paper was published in August 2020 in an Indian junk journal. [https://www.granthaalayahpublication.org/journals/granthaalayah/article/view/IJRG20_B07_3568] For the sake of convenience, I'll refer to the author of the paper as simply Perez, who appears to have done most of the work on the paper.

Location of regions A and B

Perez confusingly did not use Wuhan-Hu-1 as his reference genome but another early sequence from Wuhan. [https://www.ncbi.nlm.nih.gov/nucleotide/LR757998] It's missing the first 25 bases from the 5' end of Wuhan-Hu-1, so the genome coordinates given by Perez are off by 25 relative to Wuhan-Hu-1 coordinates.

Perez identified two contiguous regions with a high number of matches to HIV or SIV, which he called region A and region B:

Perez indicated that region A was 600 bases long but it matched bases 21072 to 21672 of the reference genome, which would mean that region A would be 601 bases long if both ends of the range would be inclusive. But the end of the range is exclusive and Perez started numbering the bases from zero and not one, so the region matches bases 21073 to 21672 in regular one-based numbering where both ends of the range are inclusive:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=LR757998'>perezref.fa
$ seqkit locate -p AGGGTTTTTTCACTTACATTTGTGGGTTTATACAACAAAAGCTAGCTCTTGGAGGTTCCGTGGCTATAAAGATAACAGAACATTCTTGGAATGCTGATCTTTATAAGCTCATGGGACACTTCGCATGGTGGACAGCCTTTGTTACTAATGTGAATGCGTCATCATCTGAAGCATTTTTAATTGGATGTAATTATCTTGGCAAACCACGCGAACAAATAGATGGTTATGTCATGCATGCAAATTACATATTTTGGAGGAATACAAATCCAATTCAGTTGTCTTCCTATTCTTTATTTGACATGAGTAAATTTCCCCTTAAATTAAGGGGTACTGCTGTTATGTCTTTAAAAGAAGGTCAAATCAATGATATGATTTTATCTCTTCTTAGTAAAGGTAGACTTATAATTAGAGAAAACAACAGAGTTGTTATTTCTAGTGATGTTCTTGTTAACAACTAAACGAACAATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTACAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTTTATTACCCTGACAAAGTTTTCAGATCC perezref.fa|cut -f5,6|column -t
start  end
21073  21672

Regions A and B combined consist of bases 21098 to 22027 of Wuhan-Hu-1. Region A consists of the last 458 bases of ORF1ab, the 7-base intergenic region between ORF1ab and the spike protein, and the first 135 bases of the spike protein. Region B consists of bases 136 to 465 of the spike protein.

Table of 15 BLAST matches to HIV and SIV

Table 1 of Perez's paper showed matches to regions A and B in various sequences of HIV-1, HIV-2, and SIV. Perez deceptively omitted the E-values from his table, which would've shown that none of his matches came even close to having an E-value below the significance level of 0.05, but Perez incorrectly said that any match that was 18 bases or longer was "significant", even if it had multiple mismatches:

The table has several errors:

It's also confusing how Perez used zero-based indexing for the starting and ending positions in the last column, and not regular one-based indexing.

When I downloaded all 15 sequences in the table and I did a BLAST search for the sequences against SARS-CoV-2, there were no matches returned when I ran BLAST with the default settings:

$ cat perez # fixed errors mentioned above and converted to 1-based indexing
JN230738.1 21138 21153
MF373163.1 21226 21246
JN863831.1 21308 21325
KR862351.1 21438 21458
EU875177.1 21543 21573
JF267434.1 21584 21601
KJ131112.1 21695 21714
AF003044.1 21749 21768 # the starting and ending positions on these
JN091691.1 21701 21722 # two rows were accidentally swapped
HQ644953.1 21757 21784
L07625.1 21804 21829
JF811228.1 21851 21866
KC187066.1 21884 21915
GU481454.1 21914 21952
LM999945.1 21941 21970 # the starting position of this row was too high by 10
$ curl "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=$(cut -d\  -f1 perez|paste -sd, -)">perez.fa
$ brew install blast
[...]
$ makeblastdb -dbtype nucl -in perez.fa
[...]
$ fmt='sseqid evalue nident length pident sstrand qstart qend'
$ <perezref.fa blastn -db perez.fa -outfmt "6 $fmt"
$ # no results when BLAST is run with default settings

So therefore in order to use less strict matching criteria, I added the options -word_size 5 -evalue 100, which gave me one or more matches for all 15 sequences. At first the starting position of one of my matches wasn't the same as in Perez's table, but I got the starting positions to match when I added the option -task blastn:

$ <perezref.fa blastn -db perez.fa -outfmt "6 $fmt" -task blastn|awk '$7>=21073&&$8<=22027'|awk 'NR==FNR{a[$1]=$2" "$3;pos[$1]=NR;next}{print pos[$1],$0,a[$1]}' perez -|awk '{print$0,$8==$10&&$9==$11?"true":"false"}'|sort -rk12|sort -sgk3|awk '!a[$1]++'|sort -n|cut -d\  -f2-|(echo $fmt perezstart perezend matchesperez;cat)|column -t
sseqid      evalue  nident  length  pident   sstrand  qstart  qend   perezstart  perezend  matchesperez
JN230738.1  1.3     16      16      100.000  plus     21138   21153  21138       21153     true
MF373163.1  0.003   21      21      100.000  minus    21226   21246  21226       21246     true
JN863831.1  4.7     17      18      94.444   minus    21308   21325  21308       21325     true
KR862351.1  0.11    20      21      95.238   minus    21438   21458  21438       21458     true
EU875177.1  0.009   28      32      87.500   minus    21543   21573  21543       21573     true
JF267434.1  0.11    18      18      100.000  plus     21584   21601  21584       21601     true
KJ131112.1  0.38    19      20      95.000   minus    21695   21714  21695       21714     true
AF003044.1  0.38    19      20      95.000   plus     21749   21768  21749       21768     true
JN091691.1  0.38    20      22      90.909   minus    21701   21722  21701       21722     true
HQ644953.1  0.009   25      28      89.286   plus     21757   21784  21757       21784     true
L07625.1    1.3     22      26      84.615   plus     21804   21829  21804       21829     true
JF811228.1  1.3     16      16      100.000  minus    21851   21866  21851       21866     true
KC187066.1  0.009   28      32      87.500   minus    21884   21915  21884       21915     true
GU481454.1  0.009   32      39      82.051   minus    21914   21952  21914       21952     true
LM999945.1  0.38    25      30      83.333   minus    21941   21970  21941       21970     true

In the table above, the E-value indicates how many similarly close or closer matches are expected to occur by chance for a given query in a given database. A bigger database size means higher E-values. But even though in the code above I had a tiny database that consisted of only 15 sequences of HIV and SIV, 4 out of 15 matches above got an E-value above 1, which means that more than 1 similar matches are expected to occur by chance even within the tiny database. And even the lowest E-value was only about 0.003.

The output above shows that 10 out of 15 matches are on the minus strand, which means that HIV/SIV matched the reverse complement of the segment in SARS-CoV-2, so the matched segment does not even code for the same amino acids in SARS-CoV-2 and HIV/SIV. For example the second row of my output shows a match to a Swedish HIV sample from 2017, but the match is on the minus strand, so the amino acid translation is completely different in SARS-CoV-2 and HIV: [https://www.ncbi.nlm.nih.gov/nuccore/MF373163]

SARS-CoV-2:                Swedish HIV sequence:
                            <--------------------
 -------------------->      TACGAAGTCTACTACTGCGTA # reversed version of segment matched in SARS-CoV-2
 ATGCGTCATCATCTGAAGCAT      ATGCTTCAGATGATGACGCAT # reversed version with complemented bases
AATGCGTCATCATCTGAAGCATTT   TATGCTTCAGATGATGACGCATAT
 N  A  S  S  S  E  A  F     Y  A  S  D  D  D  A  Y

After the 10 matches on the wrong strand are eliminated, only 5 out of 15 matches remain. But 2 out of the 5 matches are in a different frame in SARS-CoV-2 and HIV/SIV, so their amino acid translation is not the same, which means that only 3 out of the 15 matches in Perez's table are both on the right strand and in the right frame:

accession SC2 start SC2 CDS start SC2 frame HIV start HIV CDS start HIV frame same frame
JN230738 21138 20899 1 77 77 2 false
JF267434 21584 47 2 284 284 2 true
AF003044 21749 212 2 845 845 2 true
HQ644953 21757 220 1 967 967 1 true
L07625 21804 267 3 6701 23 2 false

In the table above, the "CDS start" columns show the starting position of the match within the protein coding sequence the match is part of. For example the match on the first row starts at base 20899 of ORF1ab in SARS-CoV-2. By calculating (20899-1)%3+1, you get the frame number which is 1.

Expect values of Perez's matches at web BLAST

In order to see how high the E-values of Perez's matches were in the full nucleotide database, I copied this sequence which consists of Perez's regions A and B:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=MN908947'>sars2.fa
$ seqkit subseq -r 21073:22027 sars2.fa|seqkit seq -s
GTTACAAAAGAAAATGACTCTAAAGAGGGTTTTTTCACTTACATTTGTGGGTTTATACAACAAAAGCTAGCTCTTGGAGGTTCCGTGGCTATAAAGATAACAGAACATTCTTGGAATGCTGATCTTTATAAGCTCATGGGACACTTCGCATGGTGGACAGCCTTTGTTACTAATGTGAATGCGTCATCATCTGAAGCATTTTTAATTGGATGTAATTATCTTGGCAAACCACGCGAACAAATAGATGGTTATGTCATGCATGCAAATTACATATTTTGGAGGAATACAAATCCAATTCAGTTGTCTTCCTATTCTTTATTTGACATGAGTAAATTTCCCCTTAAATTAAGGGGTACTGCTGTTATGTCTTTAAAAGAAGGTCAAATCAATGATATGATTTTATCTCTTCTTAGTAAAGGTAGACTTATAATTAGAGAAAACAACAGAGTTGTTATTTCTAGTGATGTTCTTGTTAACAACTAAACGAACAATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTACAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTTTATTACCCTGACAAAGTTTTCAGATCCTCAGTTTTACATTCAACTCAGGACTTGTTCTTACCTTTCTTTTCCAATGTTACTTGGTTCCATGCTATACATGTCTCTGGGACCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTTTATTTTGCTTCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTACTACTTTAGATTCGAAGACCCAGTCCCTACTTATTGTTAATAACGCTACTAATGTTGTTATTAAAGTCTGTGAATTTCAATTTTGTAATGATCCATTTTTGGGTGTTTATTACCACAAAAACAACAAAAGTTGGATGGAAAGT

Then I pasted the sequence to the text box here: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn. I changed the database type to "Nucleotide collection (nt/nr)", which used to be the default database back when Perez wrote his paper, and which has slightly more HIV sequences than the new "core_nt" database. I entered "HIV-1 (taxid:11676)" in the organism field, clicked "Add Organism", entered "HIV-2 (taxid:11709)", clicked "Add Organism", and entered "Simian immunodeficiency virus (taxid:11723)". I typed "0:2019[dp]" under "Entrez Query" to only select sequences with date of publication before 2020. And then under "Program selection", I changed the algorithm from "megablast" to "blastn", because otherwise short matches wouldn't have been returned. And under "Algorithm parameters", I increased "Expect threshold" from 0.05 to 10000, so that even matches that have more than 5% likelihood to be due to chance will be returned, and I also increased "Max target sequences" from 100 to 5000. Then I clicked "BLAST".

The best match had an E-value of about 1.4, which was the perfect 21-base match to the Swedish HIV sequence that was shown on the second row of Perez's Table 1. But the next best match had an E-value of about 5.0, which means that about 5.0 similarly close or closer matches are expected to occur by chance:

If I would've omitted the step where I increased the expect threshold from 0.05 to 1000, BLAST would have returned zero results and said "No significant similarity found", because none of the matches had lower than 5% likelihood of occuring by chance.

Next in order to download a TSV file for the results, I selected "Hit Table (text)" from the "Download" menu, and I kept only results which were included in Perez's Table 1. The expect value was over 100 for 9 out of 15 results:

Subject E-value Percentage
identity
Length Mism-
atches
Query
start
Query
end
Subject
start
Subject
end
Strand
JN230738.1 HIV-2 isolate 56 from France envelope glycoprotein (env) gene, partial cds 746 100.000 16 0 91 106 77 92 +
MF373163.1 HIV-1 isolate 060SE from Sweden, partial genome 1.4 100.000 21 0 179 199 5634 5614 -
JN863831.1 HIV-2 isolate CA65410.13 from Guinea-Bissau envelope gene, partial cds 2604 94.444 18 1 261 278 436 419 -
KR862351.1 Simian immunodeficiency virus isolate VSAA2001, complete genome 61 95.238 21 1 391 411 8635 8615 -
EU875177.1 HIV-1 clone ML1592n from Kenya nonfunctional vpu protein (vpu) gene, complete sequence; and
nonfunctional envelope glycoprotein (env) gene, partial sequence
5.0 87.500 32 4 496 526 270 239 -
JF267434.1 HIV-2 isolate 05HANCV37 from Cape Verde envelope glycoprotein (env) gene, partial cds 61 100.000 18 0 537 554 284 301 +
KJ131112.1 HIV-2 isolate 106CP_RT from Cote d'Ivoire reverse transcriptase gene, partial cds 214 95.000 20 1 648 667 85 66 -
AF003044.1 Simian immunodeficiency virus isolate P18 patient P1, gp120 (env) gene, partial cds 214 95.000 20 1 702 721 845 864 +
JN091691.1 Simian immunodeficiency virus isolate TAN5 from Tanzania, complete genome 214 90.909 22 2 654 675 2801 2780 -
HQ644953.1 HIV-1 isolate 19828.PPH11 from Netherlands envelope glycoprotein (env) gene, partial cds 5.0 89.286 28 3 710 737 967 994 +
L07625.1 Human immunodeficiency virus type 2 complete genome from strain HIV-2UC1 746 84.615 26 4 757 782 6701 6726 +
JF811228.1 HIV-2 isolate H2A62_111808_CINT_WBC_25 from Senegal pol gene, partial sequence 746 100.000 16 0 804 819 803 788 -
KC187066.1 HIV-1 isolate 4045_Plasma_Visit1_amplicon9 from Malawi envelope glycoprotein (env) gene, complete cds 2604 90.000 20 2 849 868 431 412 -
GU481454.1 HIV-1 isolate 07.RU.SP-R497.VI.F5 from Russia envelope glycoprotein (env) gene, complete cds 5.0 82.051 39 5 867 905 1064 1029 -
LM999945.1 Simian immunodeficiency virus partial pol gene for Pol, isolate SIVagmTAN-CM545-pol 214 83.333 30 5 894 923 1098 1069 -

Version of Perez's graphic with E-value and strand added

The image below has been posted on Twitter by Perez and other people like Johanna Deinert. [https://x.com/JCPEREZCODEX/status/1920908991925776671] The image misleadingly doesn't show the expect value or strand of the matches, which I rectified by adding the green and red pieces of text to the image. The matches with the right strand and frame are shown in green, and matches a the wrong strand or frame are shown in red. There's only two green matches, but both of them have a very high E-value:

I took the E-values from the table in the previous section, which shows the E-values when I searched for regions A and B of Wuhan-Hu-1 against sequences in the nt database with the species HIV-1, HIV-2, or SIV. The expect values are directly proportional to the length of the query sequence, and regions A and B are 955 bases long so they account for about one thirtieth part of the length of the whole genome of SARS-CoV-2, so if I would've searched for the whole genome instead of only regions A and B, then the E-values would've been about 30 times higher.

In Perez's graphic, it's also misleading that he drew the arrows of all 8 matches from left to right, even though 5 out of 8 matches were on the minus strand so the arrows should've been drawn from right to left.

Additional matches to HIV and SIV outside regions A and B

Perez's Table 1 showed 15 matches within regions A and B, but his Table 2 shows 4 additional matches outside of regions A and B:

However 3 out of 4 matches in the table are on the minus strand:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=LR757998'>perezref.fa
$ printf %s\\n 'KM378564.1 8752 8770' 'EU184986.1 14341 14378' 'AY516986.1 20374 20401' 'HQ217329.1 20401 20430'>perez2
$ cut -d\  -f1 perez2|curl -sd "id=$(paste -sd,)" 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta'>perez2.fa
$ makeblastdb -dbtype nucl -in perez2.fa
[...]
$ fmt='sseqid evalue nident length pident sstrand sstart send qstart qend'
$ <perezref.fa blastn -db perez2.fa -outfmt "6 $fmt" -task blastn|awk 'NR==FNR{a[$1]=$2" "$3;pos[$1]=NR;next}{print pos[$1],$0,a[$1]}' perez2 -|awk '{print$0,$8==$10&&$9==$11?"true":"false"}'|sort -rk12|awk '!a[$1]++'|sort -n|cut -d\  -f2-|(echo $fmt perezstart perezend matchesperez;cat)|column -t
sseqid      evalue    nident  length  pident  sstrand  qstart  qend   perezstart  perezend  matchesperez
KM378564.1  3.8       22      27      81.481  minus    4696    4722   8752        8770      false
EU184986.1  4.95e-05  33      38      86.842  minus    14341   14378  14341       14378     true
AY516986.1  4.95e-05  26      28      92.857  plus     20374   20401  20374       20401     true
HQ217329.1  4.95e-05  28      30      93.333  minus    20401   20430  20401       20430     true

The first row of Perez's table is shown to match positions 8751 to 8770 of his reference genome (in his unusual numbering system with zero-based indexing and an exclusive end of the range, which would correspond to positions 8752 to 8770 in normal numbering with one-based indexing and an inclusive end of the range). But that region of his reference genome does not actually match the HIV sequence on the first row even though the region 8736 to 8755 shown in my output above does, so Perez may have accidentally entered the wrong starting and ending positions on the first row.

Only one out of the 4 matches in Table 2 is on the plus strand, but it doesn't even match HIV, because it matches an HIV integration site sequence where the first 69 bases come from an HIV long terminal repeat and the rest of the sequence comes from a human genome, but Perez's BLAST match is located entirely within the segment from the human genome: [https://www.ncbi.nlm.nih.gov/nuccore/AY516986]

Perez wrote that in the match to the integration site sequence, "addresses 20373 to 20401 comes from an HIV1 Integrase from a USA virus from 2004". He seems to have confused the term "integration site" with the HIV integrase enzyme which is contained within the pol gene. The integrase is located at positions 4236 to 5086 in HXB2, but the first 69 bases of the integration site sequence are identical to bases 112 to 180 of HXB2 (which is contained within the 5' long terminal repeat):

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=NC_001802'>hiv1.fa
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=AY516986'>integrationsite.fa
$ seqkit subseq -r1:69 integrationsite.fa|seqkit locate -if- hiv1.fa|cut -f4-7|column -t
strand  start  end  matched
+       112    180  gtctgttgtgtgactctggtaactagagatccctcagacccttttagtcagtgtggaaaatctctagca

Kenyan HIV sequence doesn't match ORF1ab

The next image demonstrates another big fail by Perez. He thought that one of his BLAST matches was located at the start of the spike protein in RaTG13 but that the match spanned both ORF1ab and the spike protein in SARS-CoV-2. But that's because his nonstandard reference genome was missing the first 25 bases of Wuhan-Hu-1, so he should've subtracted 25 from Wuhan-Hu-1 coordinates when he identified the start of the spike protein:

Matches to the parasite Plasmodium yoelii

Perez presented this match to the rodent parasite Plasmodium yoelii:

However the matching sequence is in frame 2 in SARS-CoV-2 but frame 1 in Plasmodium yoelii, so Perez's amino acid translation of the match in SARS-CoV-2 is wrong:

$ url='https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_na'
$ curl "$url&id=MN908947">sars2.na
$ curl "$url&id=LM993664">yoelii10.na
$ seqkit locate -pCACAAGTCAAACAAATTTACAAAACACCACCAATTAAAGAT sars2.na|cut -f4-6|column -t
strand  start  end
+       2348   2388 # (2348-1)%3+1 is frame 2
$ seqkit locate -pCACAAATCAAACAAATTTACAAAACACAAACCAAAAAAAAAT yoelii10.na|cut -f4-6|column -t
strand  start  end
+       106    147 # (106-1)%3+1 is frame 1
+       106    147

Next Perez presented a second match to the same rodent parasite, which he initially said appeared to be located downstream in the same protein as the first match, even though actually the match was located in a different chromosome and a different protein, and in fact Perez later corrected his own initial impression, and he wrote that "it is therefore clear that this second region of Yoelii does not coincide with the extension downstream of the sequence 'Fam a'". But for some reason Perez still decided to concatenate the two unrelated matches together. The second match to Plasmodium yoelii has two gaps near the start in SARS-CoV-2, which means that the segments before and after the two gaps are in different frames:

The screenshot above shows that the match to the whole chromosome in Plasmodium yoelii is on the minus strand, but the match to the gene in Plasmodium yoelii is still on the plus strand because the gene is on the reverse strand. And the part of the match after the gaps happens to be in the +2 frame in both Plasmodium yoelii and SARS-CoV-2. But the match is still not impressive at all, because it has only 36 out of 46 identical bases, so the percentage identity is only about 78%:

$ url='https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_na'
$ curl "$url&id=MN908947">sars2.na
$ curl "$url&id=LK934642">yoelii14.na # protein coding sequences within chromosome 14
$ seqkit locate -pCAAAACACCACCAATTAAAGATTTTGGTGGTTTTAATTTTTCACAA sars2.na|cut -f4-6|column -t
strand  start  end
+       2367   2412 # (2367-1)%3+1 is frame 3
$ seqkit locate -pCAAAATAAAACCAATTATATATTTTGATCATATTAATTTTTCAAAA yoelii14.na|cut -f4-6|column -t
strand  start  end
+       6903   6948 # (6903-1)%3+1 is frame 3

Histograms of matches per block

In the plot below I used web BLAST to search for Wuhan-Hu-1 within the nr/nt database, where I set the species to HIV-1, task to blastn, expect threshold to 1000, and maximum results to 1000. I then kept scrolling the alignment view for a couple of minutes to fetch all results, and I saved the source code of the web page (because I hadn't yet figured out that I could download the table of results as TSV from the "Download" menu). Then I made a list of the starting and ending positions of each match, and I counted how many positions were covered by at least one match. The E-values of the matches ranged from 5.2 to 776. When I divided Wuhan-Hu-1 to 500-base blocks, the three blocks with the highest covered percentage were the blocks that started at positions 21001, 11001, and 21501, where two of the blocks roughly coincide to Perez's regions A and B which cover positions 21098 to 22027. However there was also a block in ORF3a which had almost as high coverage percentage as the block at the end of ORF1b that covered the first half of regions A and B. And when I included only matches on the plus strand, the block at the end of ORF1b got 0% coverage, and the block at the start of the spike protein got 14% coverage which was about as high as three random blocks in ORF1ab:

Even though I included the top 1000 BLAST results in the plot above, there were many duplicate matches where different sequences of HIV matched the same segment, so there were only 82 unique starting positions among the matches. But next in order to search within a diverse set of HIV subtypes with only a few results by subtype, I did a BLAST search within the HIV subtype reference published by the Los Alamos National Laboratory: https://www.hiv.lanl.gov/content/sequence/NEWALIGN/align.html. It contains 555 sequences of HIV and SIV, where there's up to 5 sequences from each subtype of HIV. I got zero results when I searched for Wuhan-Hu-1 against the LANL subtype reference with the default options, but my number of results increased to 7 when I added the option -task blastn and to 609 when I also added the option -evalue 1000. There were 245 unique starting positions among the results, so now the matches were distributed more evenly because there weren't as many duplicate matches. And now even in the top panel which includes both strands, the two bars which roughly correspond to Perez's regions A and B only had the 4th and 11th highest percentage of covered bases:

Tweets by Jean-Claude Perez

I suspect Perez is deliberately producing disinformation, because he has said that vaccinated people are harboring 5G-activated nanopathogens, that vaccinated people have MAC addresses, that vaccines contain graphene oxide, and that the pandemic was fake: [https://x.com/JCPEREZCODEX/status/1875105196294201653, https://x.com/JCPEREZCODEX/status/1768971965178548510, https://x.com/JCPEREZCODEX/status/1686762168606167040, https://x.com/JCPEREZCODEX/status/1655898773774647303, https://x.com/JCPEREZCODEX/status/1671902292402995200]