Are the white clots found by embalmers a hoax? (part 1) - sars2.net

First published 2025-04-21 UTC, last modified 2026-04-08 UTC

Other parts: clot2.html, clot3.html (Kevin McCairn).

Contents

Overview

Table of people who have allegedly seen calamari clots

The table below is a complete list of people I could think of who are alleged to have seen a calamari clot in the body of a dead or living human, with the exception of some people who had only second-hand testimony with minimal information available. I tried to link to the earliest source for each person I found, but I may have missed some earlier sources. I tried to generally find UTC dates, but some dates are in an unknown timezone.

Location Type Occupation Date Interviewer or source Name Comment
USA, AL dead mortician 2022-01-26 Jane Ruby Richard Hirschman the earliest person I have found who said they saw calamari clots
USA, MO dead mortician 2022-02-12 Steve Kirsch Anna Foster possibly the second person after Hirschman who claimed they saw calamari clots
USA, AL dead mortician 2022-02-14 Steve Kirsch Cary Watkins short audio interview of an embalmer who knew Hirschman
USA, ID dead pathologist 2022-03-15 Steve Kirsch Ryan Cole showed a vial of a clot he claimed to have removed from a dead body himself
unknown living ER doctor 2022-06-13 Mike Adams anonymous male ER doctor interviewed by Mike Adams on InfoWars through a voice changer
unknown dead mortician 2022-06-20 Jane Ruby Jennifer provided photos to Jane Ruby that looked similar to Hirschman's photos
UK dead mortician 2022-06-30 Michael Gray Griffith John O'Looney had done videos for about a year before he first said he saw calamari clots
USA, IN dead mortician 2022-08-25 possibly Telegram Wallace Hooker post copied by many accounts on Twitter and Telegram; original source unknown
USA, AL dead mortician 2022-09-02 Epoch Times Larry Mills told Epoch Times that clots appear to be like earthworms
unknown dead mortician 2022-09-02 Epoch Times anonymous female told Epoch Times that corpses started to have thick blood in May 2021
South Africa living naturopath 2022-09-16 Jane Ruby Leunis van Rooyen presented as a member of a team of surgeons who had removed a calamari clot
New Zealand dead mortician 2022-09-26 Matt Shelton Brenton Faithfull interviewed by NZDSOS co-founder who also claims to have seen the clots
USA, AL dead mortician 2022-11-21 Died Suddenly Nicky Rupright King did embalming with Hirschman; said she didn't see clots until 2022
USA, AL dead mortician 2022-11-21 Died Suddenly Chad Whisnant knows Hirschman; little information available
USA dead mortician 2022-11-21 Died Suddenly anonymous male featured only briefly in Died Suddenly
unknown dead mortician 2022-11-21 Died Suddenly anonymous female featured only briefly in Died Suddenly
Canada dead mortician 2022-11-31 Died Suddenly Laura Jeffery featured as an anonymous Canadian embalmer whose face was blurred
Ireland dead mortician 2022-12-31 Off-Grid Ireland John McGhee former Scientologist and member of Anonymous
USA dead mortician 2023-02-04 Pistol Packing Pilot John (pseudonym) sounded like Hirschman; same channel interviewed Hirschman 2 months earlier
Canada dead mortician 2023-04-15 NCI Canada Mike MacIver said he started seeing clots around May or June 2021
Canada dead mortician 2023-09-30 Epoch Times Carolyn (pseudonym) possibly Laura Jeffery; draft version of article was posted to Google Docs in 2022
unknown dead mortician 2024-02-08 Steve Kirsch Lorin Ware featured in VSRF embalmer panel
unknown dead mortician 2024-02-08 Steve Kirsch Bill featured in VSRF embalmer panel
Canada dead mortician 2024-02-20 NCI Canada Mike Vogiatzakis said he first saw a new type of white fibrous clot in 2022
USA living cath lab worker 2024-02-25 Philip McMillan anonymous male cath lab whistleblower who is supposed to have contacted McMillan
USA, FL living cath lab worker 2024-04-03 Tom Haviland Mohannad Bisharat Haviland's previously anonymous cath lab whistleblower
USA, AL living radiologist 2024-05-18 Philip McMillan Phillip Triantos radiologist who is supposed to have seen calamari clots in MRI and CT scans
USA, OH dead mortician 2024-05-20 Laura Kasner anonymous female text-only testimony of a local embalmer from Ohio
New Zealand living physician 2024-09-14 Philip McMillan Matt Shelton co-founder of NZDSOS; credited in An Unholy Triad
New Zealand dead mortician 2024-12-12 NZDSOS Diane (pseudonym) text-only testimony published by NZDSOS on Twitter
Jamaica dead physician 2025-02-20 Philip McMillan Azzard Comrie McMillan's high school friend from Jamaica; claimed to see clots during autopsies
unknown living radiologist 2025-07-03 Phillip Triantos anynymous interventional radiologist whose photos were posted on Twitter by Phillip Triantos

Some anonymous people in my table might be duplicates of other people in the table.

In the table above, people with only second-hand testimony available are Mohannad Bisharat, Jennifer, and the radiologist whose photos were posted by Phillip Triantos on Twitter. I excluded some people who had only second-hand testimony available with minimal information provided, including an anonymous mortician whose video was published by Daniel Horowitz in April 2022, and the daughter of a Twitter user who said his daughter saw the clots. [https://x.com/RMConservative/status/1519475175527526401, https://x.com/chansurance/status/1543729177375002624] Sometimes embalmers have said in passing that some people they know have seen the clots, but I didn't include those people in my table either.

I only included people in my table who are supposed to have personally seen the clots in the body of a dead or living person, so my table is missing people who claim to have seen the clots when they analyzed the clots in a lab, who include Mike Adams, Ana Maria Mihalcea, Clifford Carnicom, Zandre Botha, Arne Burkhardt, Greg Harrison, Kevin McCairn, David Hunt, and Kevin McKernan. Ryan Cole is the only person I know who is supposed to have both analyzed the clots in a lab and to have personally seen the clots in the body of a human.

Tom Haviland has a jar of clots he shows during interviews, but I didn't include him in the table above because I don't know if he claims to have personally seen the clots in the body of a dead or living person. Hirschman and O'Looney also have jars of clots that they show around to people, and many people have probably seen the jars in person, but I didn't include those people in my table.

There's also a lady called Melanie who said that she saw calamari clots being formed in a surgical drain tube that was attached to her body, but I didn't include her in my table, because she didn't see the clots directly inside her own body.

I can't think of a single person who claims to have seen the clots directly in the body of a dead or living person but who does not come from an English-speaking country. Arne Burkhardt from Germany is supposed to have analyzed the clots in a lab, even though I believe he didn't say he had personally witnessed the clots inside the body of a dead or living person.

In my table above, 5 out of the last 8 people are all supposed to have seen the clots in the body of a living person, but as far as I can tell, none of the 5 people said before 2024 they had seen the clots in living people. There are only 2 people I can think of who had claimed before 2024 that they had seen the clots in the body of a living person, who are an anonymous ER doctor who was interviewed by Mike Adams on InfoWars through a voice changer, and Leunis van Rooyen who appeared on Jane Ruby's show as a member of a team of surgeons who had removed a clot from the leg of a living person. In 2023 Ryan Cole showed a photo that was later said to be a photo by Mohannad Bisharat, and Cole claimed that the photo showed a clot from a living person, but I haven't found any place where Bisharat personally claimed he had seen calamari clots before 2024.

Images posted on Twitter and infographics

Calamari clots were unknown until Jane Ruby broke the news about the clots in January 2022

Richard Hirschman did his alt media debut on the Jane Ruby Show in January 2022. I haven't found any reference to a new type of white fibrous clots that predates his interview with Jane Ruby.

Jane Ruby brags that she broke the news about the clots, but she also brags that she broke La Quinta Columna's story about graphene oxide (even though in reality the story had been covered in several places before her show, but perhaps she deserves credit for being the main person who initially popularized the story): [https://x.com/RealDrJaneRuby/status/1604355938881789952, https://x.com/RealDrJaneRuby/status/1619624953036558338]

Hirschman wrote this about his clots in 2023: "If it wasn't for people like Dr Jane Ruby, Stew Peters, Mike Adams, Maria Zeee and several others, hardly anyone would know. Dr Jane Ruby was the first one to interview me and sharing this to the world." [https://x.com/r_hirschman/status/1690094446426157056]

When Hirschman did his debut on the Jane Ruby Show, her show was part of the Stew Peters Network, which is notorious for promoting stories about strange objects being found in vaccines or in the blood of vaccinated people, including hydras, microchips, nanobots, graphene oxide, snake venom, hydrogel, robot arms, shards of glass, Neanderthal DNA, and gorilla feces. I call the stories "Stew ops", because the origin of the stories frequently goes back to the Stew Peters Network or to guests on the network. Stew Peters also says that the earth is flat and viruses are not real.

I believe the FEMA whistleblower Celeste Solum was the first person who started to say that COVID vaccines were going to contain hydrogel, but she also said that COVID vaccines contain gorilla feces and Neanderthal DNA: [https://gettr.com/post/p2rc1em2ae7]

The director of the Died Suddenly film was Stew Peters, the producer was Lauren Witzke who at the time was Stew's producer, and the editor was Nicholas Stumphauzer who was hired by Witzke and Stew to work on their movies. [http://web.archive.org/web/20221122001654/https://stewpeters.com/video/2022/11/live-world-premiere-died-suddenly/] Previously the same team produced a film called "Watch the Water", where Bryan Ardis said that COVID was caused by snake venom in tap water (which Stew's people said was "a truth satan himself has fought to suppress"): [http://web.archive.org/web/20221105032849/https://stewpeters.com/video/2022/04/world-premiere-watch-the-water/]

In the screenshot above, the description for Died Suddenly says "This documentary was made possible by Goldco." Stew's films were funded by the Jewish gold company Goldco, which provided most of the budget of the Stew Peters Network, and which had a contract with Stew that required him to release at least two documentary films per year. [pfizerstew.html#Stews_lawsuit_against_Lauren_Witzke_and_sponsorship_by_Goldco]

The story that COVID vaccines contain hydras was first rolled out on SPN about 4 months before the story about the clots. I have found no pre-SPN reference to either story: [https://web.archive.org/web/20211003082951/https://www.redvoicemedia.com/2021/09/dr-carrie-madej-first-u-s-lab-examines-vaccine-vials-horrific-findings-revealed/, https://web.archive.org/web/20220127042049/https://www.redvoicemedia.com/2022/01/worldwide-exclusive-embalmers-find-veins-arteries-filled-with-never-before-seen-rubbery-clots/]

Carrie Madej supposedly received her vaccine vials that contained hydras from Justin Leslie, who was later tasked by Project Veritas to do an undercover investigation of the clots, and who said that the clots are "teslaphoresis carbon nanotubial systems". [https://rumble.com/v6spd0f-pfizer-whistleblower-justin-leslie-joins-alex-jones-to-reveal-how-mrna-covi.html?start=1267] Todd Callender said that the clots are 5G antennas that contain hydras. [https://rumble.com/v3yowh4-bombshell-proof-embalmer-clots-are-5g-controlled-human-antennas.html, https://rumble.com/v45696i-dr.-merritt-and-attorney-todd-calendar-on-the-enemy-within.html?start=2417] The counterterrorism expert Tau Braun said that the clots consist of tissue that was programmed to grow snake venom glands by nanobots that used graphene oxide as the delivery mechanism. [https://rumble.com/v1ugjek-live-7pm-the-jabbed-are-growing-animal-venom-glands-and-ducts.html] Bryan Ardis said the clots were made of two snake venom peptides in hydrogel. [https://rumble.com/v261tp4-must-watch-mike-adams-and-dr.-bryan-ardis-break-new-ground-clots-venom-and-.html?start=479] In 2021 before the story about the white rubbery clots had been rolled out, Carrie Madej said that vaccinated people were growing clots that consisted of hydras.

But anyway, if the calamari clots are caused by COVID vaccines, then why were the clots unknown until January 2022, which was more than a year after the vaccine rollout? When I searched for early tweets about the clots using queries like embalmer clot until:2022-1-27, I didn't find a single reference to the clots that predated Hirschman's interview with Jane Ruby. [https://x.com/search?q=embalmer+clot+until%3A2022-1-27&f=live] I only found a few tweets which linked to an article from September 2021 titled "'The Clots Were The Size Of Pancakes' - Texas Embalmer Opens Up About Covid Horrors", but the article didn't discuss the new type of white clots that Hirschman is supposed to have found. [https://www.huffpost.com/entry/texas-covid-embalmers-patrick-huey_n_612feb0be4b0aac9c012139c]

I also searched BitChute for the keywords "funeral director" and "embalmer" and I sorted the results by oldest first. The results included several videos posted in 2021, but I didn't find a reference to a new type of white clots in any of the videos from 2021. [https://www.bitchute.com/search?query=funeral+director&sort=old] John O'Looney already did a lot of videos in 2021, but he didn't say he had seen the calamari clots until June 2022, and he said he first learned about the clots from Hirschman's videos. A British funeral director called Wesley did two interviews in alt media in 2021, but he didn't say he had seen a new type of clots in either interview.

Richard Hirschman

Interview by Ana Maria Mihalcea in February 2024

Richard Hirschman was interviewed by Ana Maria Mihalcea in February 2024. [https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html]

Mihalcea said that when she looked at Hirschman's sample of coffee ground clots under a microscope, "I saw that stuff was moving, and you see that these round little spheres are actually developing here. And if I speed this up, it is actually growing. And the spheres contain these little tiny blinking lights that I call quantum dot micro robots, which is the same stuff that we saw in the Pfizer vial." [32:09] And she said: "And these little blinking lights, they're maybe 500 nanometers or something like that. And they change colors from blue to yellow to red, which is exactly what quantum dot micro robots do. So this is technology for biosensing application." [33:36] And she said that when she looked at a sample of unvaccinated blood, it also contained the blinking lights, and it contained hydrogel that formed rubbery filaments, which she said was due to shedding. And next she said that calamari clots are formed when nanobots eat red blood cells: "And they are literally changing the red blood cells. They're sucking the blood dry, taking its energy, which in the nanotechnology literature - this is called energy harvesting for intra body area network. Nothing in the body is supposed to blink like this. So these are biosensors, and look at their swarming. This isn't natural, this is all technology basically, you know. And so what happens is if I just observe this stuff over a long period of time, you see that these bots literally eat up the red blood cells until nothing is left of them. This is literally forming the clot before my eyes." [35:19] And she said that 30 minutes later the bots had harvested all the electricity and life force out of the blood cells, so only a skeleton of the cells remained, where the skeleton was connected by a hydrogel polymer plastic rubber. And next she said: "The rubber stuff is made from these filaments that Clifford Cardicom calls cross-domain bacteria or Morgellons filaments. They grow out of those little round things and become larger." [38:04] And she said the rubber was what the rubbery clots were made out of.

After that Hirschman didn't have anything critical to say about Mihalcea's findings, but he just moved on to the next topic. Later Hirschman said: "I had a live blood analysis of my own blood and my blood had some of those filaments in it too." [56:26] But it's not clear if by filaments he meant Morgellons filaments like Mihalcea.

At time 43:44, Mihalcea said that the reason why vaccines have to be stored at a cold temperature is because if they're stored at a temperature above 80 degrees Fahrenheit, the vaccines turn to rubber in the vial. And she said that she was able to grow calamari clots out of footbath water: "And so, we have seen that this stuff grows outside of the body. And more than one person has observed that. We had, for example, taken the ionized footbath water of somebody who was vaccinated, and just kept it in a mason jar over six months, and a quarter of the mason jar was filled with this stuff. Just six months." Then Hirschman replied: "That's fascinating. Because I think you're right, as far as people that are having issues, I think it's probably a good idea if a doctor wants to know if they have the potential of having this to do that test, draw a 30 cc's of blood and let it sit and watch it and see what happens with it." Mihalcea's blog post about the interview was misleadingly titled "Breaking News: Embalmer Richard Hirschman Confirms Rubbery Polymer Clots Grow Outside Of The Body And Were Found In a Deceased Child". [https://anamihalceamdphd.substack.com/p/breaking-news-embalmer-richard-hirschman] But during the interview Hirschman didn't say himself that the clots grow outside the body, apart from briefly telling Mihalcea "I think you're right", which might have meant that she's right about it being a good idea to do the kind of experiments she described, and not necessarily that she was right that it's possible to grow the clots out of blood by letting the blood sit still.

At the end of the video, Hirschman said: "I don't like the infighting and stuff like that between people that are on our side trying to get rid of the shots. Have compassion on those folks. Some people get all upset if you don't want to call it what they call it. They may call it amyloid, you may call it a hydrogel, you know, nanotechnology, all these different things. And you know I think we need to hopefully - hopefully we all will come together and realize - I mean you got some pretty daggum solid proof behind you when you're showing the actual images, you're showing the blinking lights. Look, people can replicate this if they want to. They can replicate it."

So Hirschman said that this microscope imagery of blinking lights was "pretty daggum solid proof":

Hirschman did his interview with Mihalcea more than half a year after Mihalcea had published her original analysis of his clots, where she claimed that the clots contained Morgellons fibers and Morgellons bacteria. [http://web.archive.org/web/20230711070359/https://anamihalceamdphd.substack.com/p/blood-clot-analysis-from-living-and] If Hirschman was for real, wouldn't he have realized that Mihalcea was a fraud? Other people probably also told him about how Mihalcea's analysis was fake. So then why did he agree to do another interview with Mihalcea later on? And why did he say that the microscope photos of blinking lights were "pretty daggum solid proof"?

Interview with Daniel Horowitz in February 2022

In February 2022 Hirschman was interviewed by Daniel Horowitz, who I believe was the third person who interviewed Hirschman after Jane Ruby and Steve Kirsch. [https://podcasts.apple.com/us/podcast/are-the-vaccines-causing-solid-frankenstein-blood/id1065050908?i=1000551322493]

At time 36:13, Hirschman said: "John O'Looney is in the UK - he's not one of the three I'm referring to, but he's the first person - he's a funeral director that came out - and I saw a video of him last October or so. And what he described - what they're seeing over there, which he didn't put no pictures or anything - but his story of what he was seeing was almost identical to what I was seeing. And I did, you know, I did hear John O'Looney recently was asked about these kind of clots, and he said his embalmer has been struggling with this for several months now." However I believe O'Looney never said in 2021 that he saw the new type of white clots. And I haven't even found any video where he would've said he saw the clots in February or January 2022, and he did a video in June 2022 where he indicated that he only saw the clots for the first time the day when the video was recorded.

At time 44:26, Horowitz said: "You don't have any confirmed cases of seeing these crazy clots in someone that you know to be unvaccinated except for one case. Could you talk about that?" And then Hirschman answered: "Yes, there was a case that I - I was certain that this person was vaccinated by the way the blood looked. And that person wasn't, and - but then I found out, you know, that person had other medical issues, and so had received a blood transfusion." I think normally embalmers don't have access to the vaccination status or medical history of people they embalm, so did Hirschman learn from a family member that the deceased person had received a blood transfusion? If he's a trade embalmer who travels from funeral home to funeral home, then was he even present at the funeral home at the same time as the family members of the deceased person, or did he just ask for their phone number from the funeral home or something? Or did people from the funeral home tell him about the blood transfusion, or did Hirschman ask people from the funeral home to ask the family members about the medical history of the person who died?

Hirschman also didn't explain how he was able to tell if a person was vaccinated from the way the blood looked. Was he able to tell it with a naked eye, or did he look at the blood under a microscope? In order to determine if a person was vaccinated, did he only look at whether the blood contained clots, or did he also consider other attributes of the blood?

Interview by Mike Adams on InfoWars in June 2022

In June 2022 during an interview with Mike Adams, Richard Hirschman said: "Well I was asked earlier today by somebody who would like to speak to you, and he was asking if I could - you know, did I send samples of normal blood clots, and - to compare against normal blood clots. But I don't - I don't have anything like that. It seems like the clots have all changed. And I don't know what normal is anymore with the strange stuff that I'm seeing." [https://www.bitchute.com/video/Jw4nZtJXw5BK, 28:21]

But it doesn't make sense that he no longer saw any normal blood clots. Was he not even seeing normal blood clots in unvaccinated people? Laura Jeffery claimed that the calamari clots were often attached to currant jelly clots so that the calamari clots seemed like they were feeding off the currant jelly clots, so doesn't that mean that at least some embalmers were still seeing the currant jelly clots?

In Tom Haviland's 2023 embalmer survey, only about 4% of the respondents are supposed to have answered 0% to a question that asked "What percentage of the corpses in Year 2023 that you have embalmed have had traditional 'grape jelly' blood clots?" [https://www.skirsch.com/covid/EmbalmerSurvey2023.pdf]

At time 15:18 during the interview with Hirschman, Mike Adams asked to be sent another sample of clots, and he said: "By the way, just to honor the dead here. We are - you know, these people died, we believe from these clots. And I believe that if they could speak, they would want us to tell the world and sound out the alarm. And I don't want anyone out there to think, you know, that we are exploiting the tissues of these dead people for any kind of sensationalism." But isn't that's exactly what Mike Adams did? He's a grand duke of sensationalism and fear mongering. He claimed that the clots contained nanowire interface structures, and the clots contained electric circuits which would've made it possible to kill people remotely by 5G, or which would've caused people to die if there was a solar flare.

Has Hirschman even received consent from the families of the dead people to take samples from the dead bodies? It seems like something embalmers wouldn't be allowed to do.

Brenton Faithfull is a funeral director from New Zealand who was featured in the Died Suddenly film, but he said that he didn't have any photos or samples of the clots because embalmers were not permitted to photograph dead bodies or remove samples from the bodies (which actually makes sense, even though I don't know if the rules are different in the United States and New Zealand, or if the rules vary from funeral home to funeral home): "We've got to take into account the anonymity of patients. I don't have the authority to even photograph a deceased person, you know. The ethical dilemma that we face is as professionals - I think even permission to embalm a body is sought from a family - is in part of the contractual arrangements. And it's very loose, I think, most funeral homes have the same clause to perform any sanitary preservation in their judgment required, within the contract. Now that's a very loose term. Now, we don't have a license to practice anatomy, so technically we can't remove any samples. We're not allowed to." [https://rumble.com/v1odcne-new-zealand-funeral-director-brenton-faithfull-first-interview%2e.html?start=1754]

List of Richard Hirschman's early interviews

I believe the first three people in alt media who interviewed Hirschman were Jane Ruby, Steve Kirsch, and Daniel Horowitz. All of them are Jews, even though Ruby is a convert to Judaism.

Horowitz and Ruby were both early people who promoted the story about the DMED data. Horowitz also published early photos and videos of clots that I haven't seen published elsewhere earlier.

During an interview that Hirschman did with Australian National Review, he said that Wayne Crouch and Lisa Johnston from ANR were among the first people who interviewed him, even though their interview with Hirschman was published about 8 months after Jane Ruby's first interview with Hirschman. So I wanted to check how many other people interviewed Hirschman in between, but I was only able to find 4 other people, who were Steve Kirsch, Daniel Horowitz, Mike Adams, and Maria Zeee. I only included interviews that were published as video or audio, but not text-only interviews:

UTC date Interviewer Link
2022-01-26 Jane Ruby Worldwide Exclusive: Embalmers Find Veins & Arteries Filled with Never Before Seen Rubbery Clots
2022-02-08 Steve Kirsch Embalmer Richard Hirschman reveals novel clotting in 65% of cases
2022-02-16 Daniel Horowitz Are the Vaccines Causing Solid 'Frankenstein' Blood Clots?
2022-05-11 Jane Ruby Voices From The Grave with More Embalmer's Mystery Clots
2022-06-13 Mike Adams on InfoWars Mike Adams w/ mortician Richard Hirschman + Jane Ruby re fibrous clots in vaxxed
2022-07-16 Jane Ruby White Clots Grow Mysterious Ball Sacks; America Is Flying The Deadly Skies; Spartacus Part 2
2022-07-19 Maria Zeee Richard Hirschman - WARNING: EXTREMELY GRAPHIC! Structures Killing Injected 1 Year After Shot
2022-09-14 Wayne Crouch and Lisa Johnston Richard Hirschman speaks about the fibrous growths being found inside vaxxed

John O'Looney

O'Looney didn't say he saw calamari clots until June 2022

During an interview in 2024 when O'Looney was asked when he first started seeing the new type of blood clots, he answered: "So, really, in 2021, about halfway through, we started seeing lots and lots of people who were passing away suddenly, who were a lot younger than those that we were used to." [https://www.youtube.com/watch?v=wwdRfbPrGIY&t=10s] And a bit later he said this about the calamari clots: "I've got a BIE-registered embalmer who works for me full time, who's done 22 years, and he's never seen them before, uh, 2021, no." And the interviewer said: "So some people have think they've seen some small ones in 2020, but that's not your experience: it's 2021 they started, midway through 2021." And then O'Looney answered: "Yes, 100%, yeah."

However O'Looney already did a lot of interviews in alt media in 2021, but I didn't find him mentioning the calamari clots anywhere in 2021. During an interview in September 2021, the only time he mentioned blood clots was when he said: "Children will get cardio issues, inflammation of the heart. There will be blood clots and all the things I'm seeing as a funeral director. Now as a funeral director I'm seeing four main causes of death coming into me now. I'm seeing heart attack and stroke as a result of blood clot." [https://antijantepodden.com/.ajp_enep026.html, 24:59] But he didn't say anything about a new type of white rubbery clots. And also in a video that O'Looney did in December 2021, he said: "We used to see a blood clot very very rarely, but now I've seen more this year than I have in the previous 14." [https://www.bitchute.com/video/OTvtHkCNzlNE/, 0:58] But again he didn't say anything about a new type of white clots. And in another interview of O'Looney dated September 1st 2021, he didn't mention any kind of clots. [https://rumble.com/vlyri3-uk-funeral-director-seeing-alarming-rise-in-deaths.html]

There were 16 tweets which matched the search phrase from:olooneyjohn until:2021-12-31 clot, but none of them mentioned a new type of white clots. [https://x.com/search?q=from%3Aolooneyjohn+until%3A2021-12-31%20clot&f=live]

The earliest tweets I found that referred to O'Looney talking about calamari clots were from late June 2022: [https://x.com/search?q=john+o%27looney+clots+until%3A2022-8-1&f=live]

The oldest BitChute video I found where John O'Looney spoke about calamari clots was dated June 30th 2022 UTC, even though there were about 600 older BitChute videos that matched his name. [https://www.bitchute.com/search?query=%22john+o%27looney%22&sort=old]

In the video from June 2021, O'Looney said: [https://www.bitchute.com/video/hn9R5OkfTRNW, 2:21]

We had a guy in today who obviously - I can't give too much detail respect for him and his family - but he was 30 years old, triple-jabbed, and he had a post-mortem. So the family asks us to get him embalmed. And when that happens, basically they remove all the organs and put them in a plastic bag when they've done what they need to do - take samples and weigh them and look at them - and then they put them back in the body cavity and sew them up. So we have to undo that. And that then gives you obviously considerable access to that body from the inside.

And you could see all the crap hanging out of his arteries, this white stringy like. It's like a - I watched a report a little while ago from a guy called Richard Hirschman who's an embalmer in the US, and he mentioned about this, and he showed it to everyone. And there's a number of videos illustrating what it is, because we thought it was blood clots that were killing people. It's not. There's some sort of white crap that's growing inside people's arteries and it's phenomenal. It was honestly chilling to witness.

And I pulled it out of - every artery this guy had was chock-a-block full of stuff - the femoral artery, the radial artery, the carotid artery in the neck - literally you're pulling it out like spaghetti. And it grows inside the arteries, when it grows to - I mean, his aorta was literally jam packed full of it. What it is, I really don't know. It's very elastic. And it obviously cuts down the bigger it grows - it cuts down the blood supply to everywhere, and these people drop down dead, you know.

So O'Looney made it seem like he was not normally seeing calamari clots, but the reason why saw them in the case of the 30-year-old man was because the man had gotten a post-mortem examination. It's also interesting that O'Looney only said there were calamari clots in arteries, even though Hirschman says that the clots are approximately equally common in arteries and veins.

O'Looney told the same story on a video panel which featured Sam Dubé, Daria Schooler, and the "former European forces member Maverick Black". A video of the panel was published on July 6th 2022 UTC, but I don't know if the video was recorded earlier. [https://www.bitchute.com/video/aDoOHVuKWEtN/]

At time 27:01 in the video, O'Looney was asked "How long after death did you remove this material?" But he answered "He passed away on the 19th, so again, 8 days." So O'Looney appears to say that he first saw calamari clots on June 27th.

Next O'Looney said: "I've never, ever seen it before, ever, in 15 years of doing embalmings and opening people up and seeing the inside of them. This is something very unique. I've heard of being reported that we've struggled to embalm people for about 18 months now - who are jab recipients. Now, usually they're what was called a one-pointer for doing embalming. And the way that goes is we go in the carotid artery, and we make an incision halfway through. And an L-shaped pump is put in to pump formaldehyde round one way, using the arterial system. They then take that out, tie the artery off, and go in the top to do the rest of the head. Now, one incision is usually enough - unless this person is very old and was diabetic, perhaps, and known to have poor circulation, then you would have to make - but every one of them now is what's called a six-pointer, so we have to go in both sides, both arms, and both femoral arteries as well. Because you just can't get the fluid round them. And I would suggest that's because their arteries are full of that."

At time 56:54, O'Looney said: "It's not a very invasive process. You rely really on someone coming through who's had a post-mortem, because then you're going to open up the cavity and you're going to seal all these arteries that have been cut, and down - you're going to be able to look down them. And that's how we really discovered it with this guy. You know, people that haven't had a post-mortem - you're not opening them up as such, you're just making one incision. So, you know, they become apparent that they probably have got this. I knew what I was going to find because we struggled to embalm people for some time, to the point where we suspected the pump might need servicing. But it's got a pressure gauge on it that shows there's nothing wrong with the pump. It's the people's circulatory system blocked. And I knew what we would find. I kind of pre-warned Maverick before we did it. And I suspected what we'd find, and lo and behold, it was there."

So now O'Looney explicitly said that he saw the calamari clots for the first time only a few days ago, even though he said his funeral home had earlier had trouble embalming bodies because the vessels were blocked by the clots. However what he said doesn't match the story of other morticians like Hirschman, who say that the calamari clots get pushed out along with the blood when the embalming fluid is pumped in. So are the clots more sticky in England than the United States, so the clots remain attached to the walls of blood vessels in England but not in the United States?

During one interview, Hirschman said: "Well, as we're pushing fluid in, and we're not getting fluid into - like say, we'll just pick on the left arm - left arm's not getting fluid - and we can tell by the color of the arm - and so we're forced then to raise and an like an axillary or brachial up in the armpit or in the upper arm - to find the artery that feeds that limb, okay. And as I cut into the - open the artery up, I began to - you could see there was a clot inside." [https://rumble.com/v1o6sik-embalmer-richard-hirschman-the-ultimate-interview-with-photos-and-explanati.html?start=552] So if O'Looney's embalmer was not able to pump the embalming fluid to some part of the body because a blood vessel was blocked by a calamari clot, then wasn't the embalmer able to see that the color of the blocked part of the body did not change, and couldn't the embalmer have made an incision near the blocked spot so the clot could've been removed with the foreceps?

O'Looney even said that "every one of them now is what's called a six-pointer, so we have to go in both sides, both arms, and both femoral arteries as well". [https://www.bitchute.com/video/aDoOHVuKWEtN/, 28:20] So if his embalmer had to made six incisions, wasn't there even one time when the embalmer made one of the incisions close enough to a spot where a calamari clot was lodged so that the embalmer would've been able to pull out the clot with the foreceps?

From O'Looney's video panel, I didn't understand why he was communicating with the "former European forces member Maverick Black". Maverick Black has a channel on Odysee, but the only video on his channel is the video he did with O'Looney. [https://odysee.com/@MAVERICK:8b?view=content]


Added later: I now found that in April 2022 O'Looney posted a comment to a Rumble video where Hirschman removed a clot from a corpse, where O'Looney wrote "as a fuenral director i cna tell you this is 100% authentic, we too see the same issue here in the uk" (but it's not clear if he meant he saw the clots himself or if only other people in the UK saw the clots, or if by "seeing" he meant that he visually saw the clots or that he was aware of the clots because his embalmer had trouble inserting the embalming fluid): [https://rumble.com/v11qcta-unbelievable-blood-clots-video-from-embalmer-richard-hirschman.html?e9s=src_v1_upp#comment-108862323]

Later on June 9th 2022 UTC, O'Looney posted another comment to the same Rumble video, where he didn't say anything specifically about a new type of clots, but he wrote: "Since they began jabbing is has proved more difficult to get the fluid around the bodies. The fluid is pink in colour and as such you can see when it reaches the finger tips and extremeties - that is the idea. It adds a natural pink look to what would otherwise be a very pale body. Quite often now these jab receipients are so blocked up we cannot get the fluid through them and then have to manually use a syringe to inject the areas manually. This isnt normal and my embalmer has been talking about this since about feb/march of 2021 when large numbers of dead jab receipients were coming into the funeral home and we struggled to get them embalmed, they ended up being something called a '6 pointer' and that refers to 6 arteries raised to get them embalmed where normallly it is just one artery used to do the whole body, now it takes up to 6 and then manually hyperdermic syringeing them as well to get fluid in them fully." [https://rumble.com/v11qcta-unbelievable-blood-clots-video-from-embalmer-richard-hirschman.html?e9s=src_v1_upp#comment-121093563] But again, why did the embalmer never remove the calamari clots that blocked the vessels, so that O'Looney did not visually see the clots until 2022?

Interview on InfoWars in March 2024

In March 2024 John O'Looney was interviewed by Alex Jones on InfoWars. O'Looney said that he first started seeing the new clots "in 2021 - early 2021 - I saw a video by a guy called Richard Hirschman", and that soon after that he started seeing the clots himself. [https://rumble.com/v4gnag3-alex-jones-2-of-4-friday-3124-john-olooney-mortician-links-covid-jabs-and-b.html?start=652] But Hirschman didn't even start doing videos until January 2022.

At time 25:30, O'Looney said that "there were no extra deaths in 2020". Even though if you look at monthly excess ASMR for England and Wales at Mortality Watch, out of the 5 months with the highest excess ASMR since the start of 2020, 3 of the months were in 2020, and the month with the highest excess deaths by far was April 2020. [https://www.mortality.watch/explorer/?c=GBRTENW&ct=monthly&e=1&df=2020%2520Jan&bm=lin_reg] O'Looney's funeral home is located near London, and the area of London was hit particularly hard during the COVID wave in the spring of 2020.

At time 20:23, O'Looney said he has had a bunch of people in their 40s and 50s dying of cancer. But in reality cancer mortality among people in their 40s and 50s has not been elevated in England since the vaccine rollout. [https://x.com/UncleJo46902375/status/1844420592453427663]

At time 27:04, O'Looney told a story about how he was invited to a secret meeting in London:

And in September of 2021, I took a call from a guy called Mark Sexton, who's a retired police constable here in the UK. He invited me to meet in Westminster, a place called Birdcage Walk. So I attended this meeting in September - the 28th, I believe - of 2021. And present at the meeting were professor Dolores Cahill, Dr. Tess Lawrie, Dr. Sucharit Bhakdi, Dr. Steven Frost, Dr. Sam White, a lawyer and a debissare, and Philip Hylen, a barrister called Francis Hall, and a minister, very senior government minister by the name of Sir Graham Brady. Now Sir Graham is the commissioner of something called the 1922 Committee - and politics vary from country to country - but this is a guy who's the commissioner of a group of men who hire and fire prime ministers in this country, so there is no one above him politically.

So we all had five minutes because their time is precious. And I abbreviated basically what I've kind of skimmed over what I've said. And I then listened as it went round the table, all tenents told Sir Graham Brady their concerns.

And I'll be honest, I just couldn't believe what I was hearing. They said that people that have had an active ingredient will die between years two and five. And that there was no cure if they'd had an active ingredient. My jaw was on the on the table.

Then Sir Graham actually openly admitted it was above his pay grade, and he could do nothing about it. And he said whilst he would try, he couldn't promise anything. And at the end of the meeting, it was put to him by a number of us that when people find out what you've done, there will be civil unrest the like that we've never seen, there will be civil war. I'm still convinced there will be civil war if we don't stop this.

Then at time 33:46 O'Looney said there were many large prisons constructed in the UK, which he suggested was because dissidents were going to be jailed during the next pandemic, which he predicted would happen shortly after May 24th 2024. And he said 5G would be employed to trigger symptoms of sickness in vaccinated people whose bodies contained graphene oxide and nanotechnology:

Well, there are two major things that concern me. I mean, I'm 56 years old. And I've seen many governments come and go. They all make manifesto promises they never ever keep.

Well, one of those promises is successive home office ministers have promised to ease prison overcrowding. They've never ever done anything about that. And yet they've chosen a time when they're - allegedly we're in the middle of a deadly pandemic - and we have the worst economic downturn since World War II to build loads and loads of huge multimillion pound prisons, huge super prisons in the middle of a pandemic and the worst economic downturn. You know, why would we need huge super prisons?

The other thing of real concern is the 5G network has gone up now. Now, I've skimmed over the technology. I've spoken to many people who have reached out to me, who tell me this 5G network can - has the ability to influence nanotech and graphene oxide that is inside jab recipients, so that when certain frequencies are put out, it can induce adverse reactions in these recipients.

[...]

I believe that's going to happen shortly after May the 24th. And you know yourself Alex, these people are saying this. They're crazy. They're into numerology. And I'm kind of wondering if it will be perhaps the 6th of June, or something like that, where it has real resonance with that. I think shortly after they install the WHO, they're going to declare another pandemic. And they've got the numbers now to be able to do that. And then we will see real tyranny across the western and developed world.

[...]

So I believe that come May the 24th, it's going to get very dystopian very quick. And you'll be aware yourself, these rats, they know the game is up. They know that the Great Reset is suddenly be morphing into the Great Awakening. So with that, these people have become particularly dangerous as they thrash about in the death throes of their plan.

O'Looney also said that because of kidney failure caused by remdesivir poisoning, the bodies of people whose death was attributed to COVID were filled half full of fluid: "What was happening in 2021, I was picking people up from an hospital - I was told had COVID, they died from COVID - and the body bag was like half full of fluid. And I've never ever seen that before in all my years. And I remember thinking at the time, 'What could that possibly be? Why is that? Why is that like that?' And they were all bloated, they were crying, yellow tears. And from the nose and from the ears. And even being generous, as you can't pull in the deceased over, you would mark them where, you know - because they're so bursting with fluid. And I've since found out, the remdesivir kills the kidneys so the body can't process fluid. So you fill up with fluid and you drown. And there's your respiratory illness, there's your COVID." [https://www.bitchute.com/video/svO5GNPHwaqC, 40:40] But his story doesn't seem believable at all. Has anyone else reported similar pathology associated with remdesivir poisoning? Why would people killed by remdesivir be "crying yellow tears"?

What did O'Looney even mean by fluid? Lymph or blood or water? Lymph is yellow in color, and there is a surprisingly large amount of lymph because a typical amount of lymph in an adult human body is about 1.5 liters. But ChatGPT said that acute kidney injury would not lead to buildup of lymph:

Acute kidney injury (AKI) does not directly cause a buildup of lymph, but it can lead to fluid overload, which may resemble or contribute to swelling (edema) that looks similar to lymphatic buildup in some cases.

What AKI does cause:

What AKI doesn't directly cause:

However, severe AKI can worsen fluid retention, and if someone already has impaired lymphatic drainage, that excess fluid may further overwhelm the system and contribute to noticeable swelling.

Interview with Maria Zeee in January 2022

On January 29th 2022 UTC, Maria Zeee livestreamed a long interview with John O'Looney, but O'Looney did not yet say anything about a new type of white clots during the interview.

This time when he told the story about the secret meeting he had in London, he additionally said that 70% of vaccinated children were going to be sterilized: "Anyone who's had an active ingredient jab - i.e., not a clot shot, but the one that damages the immune system - has between two and five years to live. That's it. So they've got between two and five years to live. 70% of the children that are vaccinated will be sterilized as a side effect. And that was widely acknowledged. I watched reams and reams of scientific proof and evidence fell down on the table and be given to Sir Graham." [https://rumble.com/vtite4-john-o-looney-funeral-home-whistleblower-most-deaths-are-vaccine-deaths.html?start=3708]

Interview with DeAnna Lorraine on SPN

In November 2022, John O'Looney was interviewed by DeAnna Lorraine on the Stew Peters Network. [https://rumble.com/v1qzlmo-like-long-calamari-mortician-john-olooney-shocking-things-hes-seeing-in-the.html]

O'Looney said: "One guy that reached out to me called Nick - who's a mortuary manager at a big hospital down south here - he's seen a five to six hundred percent increase in what he thinks are thrombosis deaths. They're not, it's the - your arteries filling up with this white crap, that behaves like a thrombosis. What does a thrombosis do? It blocks veins and arteries and stops blood flow. That's what this stuff is doing, so they automatically label it as a thrombosis." [37:27]

However based on the data for England at Nomis, deaths with an underlying cause of thromosis or embolism were only slightly elevated in 2021 (and it might have been due to COVID and not vaccines): [https://www.nomisweb.co.uk/query/161.1/advanced.aspx]

Next O'Looney said: "In the last 18 months, I've looked after more people under 50 years old than I've ever seen, ever. To give you an idea, when I worked for the co-op, I could count the amount of people on one hand under 50 that died in a 12 month period. And this was, in a branch, doing about eight hundred, seven-eight hundred funerals a year. Now I've had that many, sometimes in a month, as a small family funeral director." [39:58]

However based on data for England from Nomis, ages 0 to 49 had only about 8% more deaths in 2021 than 2018, and less deaths in 2022 than 2021:

O'Looney says there is no COVID virus even though he was admitted to an ICU for COVID

John O'Looney has been saying since 2021 that the COVID pandemic is fake. In 2024 O'Looney tweeted: "The only way the 'virus' which doesn't exist will 'find' the unvaccinated it via 5G as targeted individuals of that tech". [https://x.com/OlooneyJohn/status/1849813034170032309] He has also shared videos by people like Andrew Kaufman and Jamie Andrews, and he has posted many tweets about how there is no COVID virus. [https://x.com/search?q=from%3Aolooneyjohn+virus&f=live]

However in January 2022 after O'Looney had been admitted to an ICU for COVID, he wrote: [https://rairfoundation.com/shocking-escape-covid-whistleblower-abused-in-uk-hospital-rescued-by-friends-interview/]

I was recently admitted to the ICU in Milton Keynes hospital after developing Covid symptoms.

I took three lateral flow tests whilst there and was told at the time I was not positive only to be told later on the ward I was positive so clearly it was inconclusive so I will say I felt and feel terrible still.

[...]

I was initially sceptical about Covid but I can confirm it's validity and it is very nasty. But I can also tell you it is 100% man-made this is not a natural virus and this is an attack on all of us - it's a bio weapon.

O'Looney says vaccines contain graphene oxide razor blades that resonate with 5G

In 2024 O'Looney quoted a tweet by Sean Adl-Tabatabai which said:

Pfizer Insider Reveals Vaccinated People Will Soon Start 'Bleeding From Every Orifice'

Covid vaccinated individuals contain dormant nanopathogens in their bodies that can be activated by an 18 gigahertz signal on the 5G network, according to a Pfizer insider who reveals that once triggered, these pathogens can cause catastrophic health effects, ranging from sudden heart and brain explosions to uncontrollable bleeding from every orifice.

And O'Looney wrote: [https://x.com/OlooneyJohn/status/1853739823086915792]

My understanding is the 5G masts, your own routers and smart phones will deliver the frequencies to resonate the Graphene oxide that is already inside you, it will act as razor blades as it resonates under the certain frequencies and cut and slashes its host internally - there is your "hemorrhagic fever" which is reality is simply remote mass murder..
You will bleed.
Graphene is the strongest, thinnest, and most conductive material known to man.
It's 40 times stronger than diamond and 300 times stronger than structural steel and it will chop you up like a fresh fillet steak if it resonates inside you and you are full of it.

Jim Ferguson is promoted by the same kind of bots that promote accounts like John O'Looney, Sudden and Unexpected, and Sense Receptor. But here O'Looney quoted a tweet about graphene oxide by Jim Ferguson:

In July 2021 O'Looney posted a TikTok video of a guy who was supposed to be a 5G installer, who said that his job was to install 5G kits which he was told to not crack open. But when he tried opening one kit, it contained a circuit board which said "COV-19". [https://x.com/OlooneyJohn/status/1419982639415631873] Then O'Looney commented "Just imagine having the ability to induce blood clots and vaccine recipients over Wi-Fi...":

However Reuters said this about the 5G video: "The circuit board was actually taken from a Virgin Media box for cable television - the casing of which can be seen on the bonnet of the van as the camera pans at the end of the footage. Virgin Media confirmed to Reuters it believed the circuit board had been taken from an old TV box, and the 'COV-19' engraving was not authentic." [https://www.reuters.com/article/idUSKBN22R35E/] So it might even be that the people who made the video left the casing of the box visible so the video would be easier to debunk.

Many anti-vaxxers suspect O'Looney of being controlled opposition who is attempting to discredit anti-vaxxers: [https://x.com/Jikkyleaks/status/1804717634270978122]


Greg Harrison also used to say that vaccines contained graphene oxide: [https://x.com/Jikkyleaks/status/1938865265355460766, https://x.com/Greg21143362/status/1642813946221715456, https://x.com/Greg21143362/status/1523259610836398081]

Phillip Triantos is one of the few people who has claimed that he has seen calamari clots in living people. But he also recorded a short dark field microscopy video, where he said: "This is a sample from a Moderna vaccine. Check out what we're looking at. Looks like possibly a piece of graphene. Look at all the little - whatever's jumping around. I have no idea what this is." [https://x.com/TriantosPhillip/status/1880493952769352129]


In August 2025, O'Looney linked to a video by David Icke and said it was one of the most important videos he had ever seen. [https://x.com/OlooneyJohn/status/1952380314124267742] In the video David Icke said he was contacted by La Quinta Columna, who told him they had confirmed what he had said about COVID since 2020, and they had also confirmed that human society was being manipulated by a non-human force. He said that vaccines contain self-replicating nanotechnology, and the purpose of the nanotechnology was to connect the human brain into the cloud. He said that blood clots, heart attacks in athletes, and turbo cancers were all explained by graphene. He also said that La Quinta Columna had found that "the effect on the body, brain, of the content of the jabs is the same as that which is found in people who have claimed to be abducted by extraterrestrials - I don't know, reptilians, grays, whatever". [https://rumble.com/v47cxob-david-icke-special-the-vaccine-exposed-tonight-at-7pm-gmt.html]

A couple of days later O'Looney posted this video of ball bearings in castor oil: [https://x.com/OlooneyJohn/status/1953456497083523197]

Articles from fake news sites tweeted by John O'Looney

John O'Looney has posted articles from The People's Voice which have said that:

Greg Harrison also retweeted this tweet, where John O'Looney posted a screenshot of a People's Voice article titled "Japan Warns Hearts of 6 Billion Vaxxed Set to Explode in Global Catastrophe":

Interview with BBC in April 2020

John O'Looney emerged in alt media in mid-2021, but about a year earlier in April 2020, he happened to randomly be interviewed by BBC: [https://www.bbc.com/news/uk-england-beds-bucks-herts-52193244]

I wouldn't be surprised if O'Looney's contact with BBC led to him being recruited as an actor in black propaganda operations.

O'Looney frequently posts articles by The People's Voice, which is run by Sean Adl-Tabatabai who used to work for BBC and MTV. After Adl-Tabatabai's career in mainstream media, he worked as the webmaster of David Icke's website, he produced some of David Icke's movies, and he founded a short-lived TV channel with Icke called The People's Voice TV. But Icke also worked for the BBC before he became a conspiracy guru.

Similar to O'Looney, Adl-Tabatabai, and Icke, Norman Fenton also says that the COVID pandemic was fake. In 2015 Fenton was one of the three people who presented a BBC documentary about climate change: [https://www.bbc.co.uk/programmes/p02jsdrk]

The other two people were David Spiegelhalter and Hannah Fry, who both later became prominent public commentators on COVID-related issues. Spiegelhalter wrote a book about COVID statistics, and Hannah Fry was the star of a BBC documentary which criticized anti-vaxxers. Fenton wrote that "Between 2016 and 2022, I attended many research seminars in the UK on using AI and Machine Learning to 'combat misinformation'". [https://x.com/profnfenton/status/1829137988355281114] His coauthor Scott McLachlan wrote that he also attended many of the same seminars, one of which was organized by Spiegelhalter. [https://x.com/LawHealthTech/status/1829139475202506974] In 2019 Fenton published a paper where he reviewed a book by Hannah Fry. [https://www.researchgate.net/publication/331812193] Fenton has also coauthored multiple papers with the psychologist Magda Osman, who is specialized in researching misinformation and the nudge method as a form of behavior modification, but she has also appeared several times on BBC and Channel 4.

Other morticians who claim to have seen calamari clots

Jane Ruby's photos from an anonymous embalmer and article by Epoch Times

In June 2022, Jane Ruby said that an anonymous embalmer had contacted her, and Ruby presented photos that were supposedly taken by the embalmer. This was one of the photos she showed: [https://rumble.com/v196g5d-live-new-embalmer-steps-forward-with-horrific-post-jab-clots.html?start=1145]

The photo looks suspiciously similar to Hirschman's photos, because it features a similar blue glove, and a similar vignette effect and local enhancement of contrast. When I searched Google Images for photos of embalming gloves, a lot of the gloves were yellow or orange or white or black. And even blue gloves often had a different shade of blue than the gloves in the photos by the anonymous embalmer and Hirschman: [https://www.google.com/search?q=embalming+glove&tbm=isch]

Next I tried searching Google Images for the phrase embalmer mortuary, and I picked photos where a glove was clearly visible. I excluded duplicate photos of the same person. I also excluded one photo that showed embalming students, one photo that looked like a staged stock photo where the people may have been actors, one photo where a person was shown in the role of a funeral director and not an embalmer, and one grayscale photo where it was not possible to determine the color of the gloves. Out of the first 12 photos that passed my criteria, only 5 out of 12 people in the photos had blue gloves, even though 2 of the people had gloves that looked like a lighter shade of blue than Hirschman's gloves:

In 2024, Hirschman posted the photo below which he said he received from an anonymous embalmer, but the glove in the photo had a similar shade of blue as the gloves in the photos by Jane Ruby's anonymous embalmer and Hirschman's own photos (even though I guess it's possible that both anonymous embalmers were the same person): [https://x.com/r_hirschman/status/1832561722743259646]

Below you can see the photos by Jane Ruby's anonymous embalmer and Hirschman's anonymous embalmer side by side with one of Hirschman's own photos. [https://x.com/r_hirschman/status/1914837898081223115/photo/2] All photos have a vignette effect and a local enhancement of contrast similar to an unsharp mask filter with a high radius (even though I don't know if effects like that are commonly applied by the camera applications on cell phones):

When I did a reverse image search for the photo by Jane Ruby's anonymous embalmer, I found that the photo was included in an article published by NTD in September 2023, where the photo was given this caption: "A series of 'white fibrous clots,' Richard Hirschman pulled out of a body. 'They are similar to calamari. The white stuff is in your face, like 'something is wrong,' Mr. Hirschman said. (Courtesy of Mr. Hirschman)". So NTD presented the photo as a photo by Hirschman, even though Jane Ruby said the photo came from an anonymous embalmer who corroborated what Hirschman was saying: [https://ntdca.com/exclusive-embalmers-speak-out-on-unusual-blood-clots/]

The article by NTD was originally published by Epoch Times, but the Epoch Times article is behind a paywall. [https://www.theepochtimes.com/world/exclusive-embalmers-speak-out-on-unusual-parasite-blood-clots-5121795] Epoch Times and New Tang Dynasty are operated by Falun Gong, whose leader Li Hongzhi teaches that people can learn to levitate through a practice known as developing a "greater cosmic orbit". [https://falundafa.org/eng/eng/pdf/zflus.pdf#page=168] He teaches that one type of aliens are disembodied ghosts, and another type looks like humans but they have a nose made of bone. He says that aliens have taught humans to develop science so humans will build clones, and then the aliens will trick humans into outlawing natural reproduction, because only alien souls but not human souls can reincarnate into clone bodies, and then the aliens will take over the earth (which is reminiscent of how Scientologists believe that humans are possessed by the souls of evil aliens, which were trapped on the earth when Xenu's prisoner transport ship crashed into a volcano). [https://time.com/archive/6954898/interview-with-li-hongzhi-2/, https://www.falundafa.org/book/eng/us_west1999.htm]

The article by Epoch Times included comments by Richard Hirschman, John O'Looney, Ryan Cole, "Dr. Roger Hodkinson, CEO and medical director of Edmonton-based MedMalDoctors", "Sarah, who is going to school in Wisconsin to get her funeral director's licence", and "Carolyn, a funeral home director in Ontario with more than 25 years of embalming experience".

When I searched for text in the Epoch Times article in double quotes, I found that parts of a similar article had earlier been posted on some random website in late 2022. [https://web.archive.org/web/20221206095726/https://pennybutler.com/funeral-directors-covid/] The source linked on the website was a document at Google Docs, which seems to have been a draft version of the article that was later published by Epoch Times. [https://docs.google.com/document/d/1Pbn3w73ZW04VJrg4DA7ZUzJWx2YPVJEZ75nkmk2pjRk] The document was created in October 2022, but the author of the document is not shown anywhere:

The article at Google Docs said: "Three embalmers provided photographs they personally took of the clots to the Western Standard." But the author of the Epoch Times article was Matthew Horwood, who also writes for Western Standard.

But anyway, the article by Epoch Times also had another interesting parallel with Jane Ruby's video, which is that Jane Ruby's anonymous embalmer said that the calamari clots appeared to be feeding on regular blood clots, which is also what the funeral home director Carolyn said in the Epoch Times article.

The draft version of the Epoch Times article included the following three paragraphs, even though the first and third paragraphs were later omitted from the published article:

While normal blood clots are dark brown in colour, Carolyn said the fibrous masses are white. But she said they also have a pinkish tone, as they are "literally feeding off of blood clots."

"They remind me of parasites, because they're creating a blood clot and they're feeding off it," she said. "So every tentacle is basically down a part of the circulatory system, and at the end of those fingers there is a normal clot, and it looks like they're feeding off it."

Hirschman also said that the fibrous clots appeared to be feeding off normal blood clots.

In the video where Jane Ruby showed the photos by the anonymous embalmer, Jane Ruby also showed the photo below and said: "And notice the red, you know, sort of embedded clot like - you know, these things - these things are not just next to clots, they are actually attached in some cases. You'll see in a minute. And again, this particular embalmer said to me to that effect, and I didn't prompt the embalmer with Mr. Hirschman's comment - remember Mr. Hirschman's said it kind of looks like the white fibrous thing is emanating out of a regular blood clot, like it's feeding out of it. This embalmer - whose picture you're seeing right now, 'Normal, NOT Normal' - said it looks like it's being fed by the blood clot. Like unsolicited on their own, they said this. Uh, I thought that was stunning." [https://rumble.com/v196g5d-live-new-embalmer-steps-forward-with-horrific-post-jab-clots.html?start=532]

And next Jane Ruby showed the photo below and said: "This one is, it's number 105. And I called it the fish. Because it's disgusting. And it looks like a fish. And it's really gross. You see how that clot on the right upper - like it's sort of at the top - but sort of the second half to the right - and it's a long, sinewy clot. And it appears to go underneath the white fibrous clot. And it almost has like vessels in the mid center there. And then further up on the top of this piece, it's there is a clot that appears to be under the sheath. Right? Like under a little bit of this thing. And then of course on the bottom part of length wise of this piece, you see this long black - it does look like it's feeding on the blood. And this could be a clue. Because this is the second time an embalmer has said this to me, okay. Really horrific, isn't it?" [14:40]

Epoch Times said that Carolyn was a "funeral home director in Ontario with more than 25 years of embalming experience", so she might have been Laura Jeffery, who is from Ontario and who said in 2024 that she had done embalming for 29 years. [https://x.com/search?q=from:LauraJayJayJay+ontario&f=live, https://x.com/LauraJayJayJay/status/1807893582751113657] I believe Laura Jeffery briefly appeared in Died Suddenly as an anonymous Canadian embalmer whose face was blurred, who said that "The fibrinous mass clots had been fed by blood clots at the ends that were integrated into the fibrinous mass clots." [https://rumble.com/v21zezm-the-died-suddenly-documentary.html?start=862] In 2023 when she provided a testimony to NCI Canada under her own name, she said: "Then there's a blood clot that is integrated into the end of those tentacles. It felt like it was a parasite that was feeding off a blood clot that it created in the body. When you think of a parasite, you think - Because it feeds off of something, right? Then you see the jelly clots at the end of this parasite. You see those and you think, 'Are they feeding off us as humans? Out of our circulatory system?' Because they always had the currant jelly integrated at the ends." [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf]

But even if Laura Jeffery is the same person as Carolyn and the anonymous mortician in Died Suddenly, there are still at least two other morticians besides her who have said that the calamari clots appear to be feeding on regular blood clots, who are Hirschman and Jane Ruby's anonymous embalmer.

It seems unusual that multiple different morticians would use terminology that one type of clot was feeding off another type of clot. It should be clear that the calamari clots don't even have a digestive system so that they could eat and digest biological material, but both Laura Jeffery and Carolyn seem to have said that the calamari clots were literally feeding on regular blood clots.

Laura Jeffery

Laura Jeffery is a funeral director and embalmer from Ontario. She was likely featured as anonymous Canadian mortician in Died Suddenly, and she may have been the anonymous funeral director from Ontario who was interviewed by Epoch Times in 2022. But I didn't find her saying under her own name that she saw the clots until her testimony in August 2023 to the Canadian National Citizens Inquiry. [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf, https://rumble.com/v2fuj08-licensed-funeral-director-laura-jeffery-on-post-vaccine-embalming-nci.html]

Jeffery said that the new type of clots reminded her of parasites, and that the new type of clots were feeding off the "currant jelly clots":

The first time I saw it I thought it was a parasite. We have something called drainage forceps. I use a pair, generally speaking, that are about this long and that have a handle port. You can squeeze them like tweezers, right? So curved tweezers, think of them that way. I use that to pull anything out of the way on the venous side of the body, where you're draining the return blood. And all of a sudden, I was having trouble. I couldn't understand. Then I pulled it out and I went and I kind of - you can turn the drainage forcep and you can see what's in it. I'm sort of like this and I see something that I thought was a tapeworm. Which was weird, because tapeworms shouldn't be in a circulatory system. And then I'm looking at this and I'm thinking, "Is this a parasite?" Because a tapeworm's a parasite; that looked like a parasite. And it was at that point, maybe, like three, four inches long. That's a small one. But at that point, that was a huge one for me, because I'd never seen this before. This was a whole new anomaly.

[...]

Okay. Have you ever seen those erasers that you push out and they're like a pen, but they're a circle? They're round, cylindrical. You think of one of those but then it maybe has a couple of little tentacles of eraser coming out the end. Then there's a blood clot that is integrated into the end of those tentacles. It felt like it was a parasite that was feeding off a blood clot that it created in the body. When you think of a parasite, you think - because it feeds off of something, right? Then you see the jelly clots at the end of this parasite. You see those and you think, "Are they feeding off us as humans? Out of our circulatory system?" Because they always had the currant jelly integrated at the ends. It's something to see, let's put it to you that way. It's horrific.

Laura Jeffery also tweeted: "Yes ... a regular current jelly clot is often incorporated in the end of the amyloid clot ... which is confusing ... is it feeding from our blood OR is it simply stopping blood flow and the current jelly clot is created?" [https://x.com/LauraJayJayJay/status/1807896656047636666]

Laura Jeffery seems to have somehow helped run a survey for Tom Haviland and Laura Kasner, because in 2024 she tweeted: "Ret'd USA Major Thomas Haviland amd Laura Kasner have created a World Wide Survey. If you or someone you know has suffered clotting since 2021 and needed Surgery or Catherziation because of clots, please take 3 minutes and fillout this survey:" [https://x.com/LauraJayJayJay/status/1829476769222537242] When someone asked her to link to the survey, she replied "Working on it!", and then in another reply she linked to a page for the survey at Survey Monkey:

She posted this reply to a video of military personnel marching: "In the 90s ... if we marched like that, we'd be punished. And that was the Airforce Cadets." [https://x.com/LauraJayJayJay/status/1898781555314569324] So she seems to have been trained as a cadet in the Air Force (even though I don't know if she later served in the Air Force, or if she meant the Canadian or US Air Force). She also tweeted: "I wouldn't join any organization that thinks they own my mind, body, heart and soul. The military's medical system kept me out 30 years ago." [https://x.com/LauraJayJayJay/status/1789305430394466661] Maybe it's just a coincidence, but there are several Air Force people connected to the clots, because Tom Haviland is a retired Major General in the US Air Force. And the Died Suddenly movie included a long segment about the DMED data that was presented by Theresa Long and Pete Chambers, who were both medical officers in the US Air Force. And Ryan Cole is the earliest person I know who claimed to have seen the clots but who was not a mortician, but he said that was a "former Air Force guy" and a "former Air Force Academy cadet". [https://rumble.com/vxeqvu-pathologist-on-ryan-cole-on-the-mystery-blood-clots.html?start=972, https:///WEEKLY_WEBINAR_APRIL24_2024?t=928, https://x.com/search?q=from%3Adrcole12%20air%20force&f=live] The Pentagon operated an anti-vaccine psyop campaign on social media out of MacDill Air Force Base in Florida, but Jane Ruby and the Died Suddenly crew are based in Florida. [https://www.reuters.com/investigates/special-report/usa-covid-propaganda/] Theresa Long's bio had an entry for the 7th Special Forces Group, which is stationed at the Eglin Air Force Base in Florida. [https://web.archive.org/web/20210929003149/https://americasfrontlinedoctors.org/2/wp-content/uploads/2021/09/AFFIDAVIT_OF_LTC2_Long.pdf]

When I searched for tweets about Laura Jeffery, I found that clips of her testimony for NCI Canada were posted by SenseReceptor and bambkb, which are both part of a network of accounts that post video clips from controlled alt media and that are artificially amplified by bots: [https://x.com/SenseReceptor/status/1645901270463442945, https://x.com/bambkb/status/1701720910548307973]

Videos of her testimony were also posted by many accounts which promote Miles Guo (which are probably bots, even though Miles Guo's movement also includes members who are known as "ants" who promote Guo's content in a bot-like manner): [https://x.com/search?q=funeral+director+laura+jeffery&f=live]

In another tweet where bambkb wrote about Laura Jeffery's testimony, he also posted a video of the alternative health practitioner Kelly Blacher, who said that after the COVID vaccines were rolled out, people's blood has contained self-assembling structures that glowed in the dark, and she said: "And then they are morphed into whatever organism I'm looking at. They look crab-like, or squid, or like something - it looks like tentacles, segmented tentacles, kind of like a spider. But I never saw these things before. Never. And then there's the metallic kind of looking pieces that eventually degrade, but that turn into a living thing." [https://x.com/bambkb/status/1642948624383352834]


During a video panel hosted by National Citizens Inquiry Canada, Laura Jeffery claimed that she spoke to a guy at a gas station who had COVID in November 2019, because he had worked with military members who had been to Wuhan. She said: "And I also spoke to a guy during the whole essential worker thing. I was at the gas station in the middle of the night, and I kind of looked over and I said, 'Essential worker?' And he goes, 'Yeah.' And I said, 'Oh,' I said, 'I think I had it in January.' And he goes, 'Oh, I had it last November.' And I said, 'Well, how'd you manage that?' And he says, 'Well, I worked with military members and they had just been over to Wuhan', and he said, 'Yeah, it's really nasty. It stuck around my way from my daughter and our household for quite a while.'" [https://rumble.com/v4empqz-live-with-nci-a-round-table-discussion-with-dr.-mark-trozzi-and-leading-exp.html?start=1365]

Sasha Latypova said that when she got COVID, it was "definitely a neurotoxin poisoning". [https://x.com/sasha_latypova/status/1818292872569106655] At time 22:08, Laura Jeffery similarly said that COVID was like a neurotoxin poisoning: "I also personally got really sick for three days, the beginning of January, and subsequently I've had Dr. Pilloch test me for antibodies, so that was January of 2020. And I felt like I had been poisoned. It was like a neurotoxin for me." Laura Jeffery also tweeted: "I had covid before it was cool, 1st week for January 2020. Felt like a neurotoxin, awake sleeping hellscape for 4 days, the bathroom trip was a safari, my body fought like a tiger. Back to work the next day, sluggish for 2 months. Doc Pelech confirmed." [https://x.com/LauraJayJayJay/status/1911221873045622937] The first COVID case in Canada was only reported on January 25th.

It seems unlikely that so many people in alt media would be early COVID survivors, including Steve Pieczenik who claims that he had the first case of COVID in the United States, and Kevin McCairn who claims that he got COVID from the Korean superspreader event in November or December 2019, even though the superspreader event only occurred in February 2020.

Brenton Faithfull

In 2022 during an interview with Matt Shelton, Brenton Faithfull said that about 95% of people who passed through his funeral home had been vaccinated within two weeks: "When I started counting in the August of last year, it was one after the other, after the other, after the other. And when I got to 20, there was 19, 19 who had died within two weeks. So carrying on from 20, so the first 20 years, I counted 19 of them, so it's 95%. The next, number was 100% of the people who died had been vaccinated within two. So it depends when the booster has come out, and the first and the second vaccine has come out, and then the booster, it'll go on a wave. So, you know, 100%, and then it'll drop to 90%. So I've got the statistics, 95% of the people who have passed away - through the work that I've done - has been vaccinated with the two weeks." [https://rumble.com/v1lsnnq-brenton-faithfull-funeral-director-speaks-to-dr.-matt-shelton-about-what-he.html?start=978] At time 32:02, Faithfull also said that at the height of the first and second booster rollout, about 95% of all deaths he saw were in people who had been recently vaccinated.

However his anecdotal statistics don't match Barry Young's New Zealand dataset, which includes mortality data for about half of all vaccinated people in New Zealand. Barry's dataset has a very low number of deaths in the first two weeks after vaccination (which is because of the healthy vaccinee effect, where people tend to not get vaccinated if they are currently ill or on their deathbed):

t=fread("https://github.com/skirsch/NewZealand/raw/refs/heads/main/data/nz-record-level-data-4M-records.csv.gz")
for(i in grep("date",names(t)))t[[i]]=as.Date(t[[i]],"%m-%d-%Y")
a=t[,.(dead=.N),,.(weeks=as.integer(date_of_death-date_time_of_service)%/%7+1)]
a[weeks>=0&!is.na(weeks)][1:10]|>print(r=F)
# weeks dead # deaths by weeks after vaccination
#     1  357 # week 1 is day of vaccination and next 6 days
#     2  564
#     3  636
#     4  718
#     5  727
#     6  741
#     7  773
#     8  805
#     9  822
#    10  881

There is also a low number of deaths during the first two weeks after vaccination in the Czech record-level datasets, in the Medicare data Kirsch received from a source at HHS, and in the English ONS data: [rootclaim.html#Fenton_and_Neils_miscategorization_bias]

And anyway if 95% of deaths were in people who had been vaccinated within two weeks, does it mean that there was about 20 times the normal number of deaths? Faithfull didn't mention if deaths from other causes remained stable or not. But in either case, around August 2021 when Faithfull claimed that about 95% of deaths were in recently vaccinated people, New Zealand had close to 0% excess deaths:

t=fread("NZL_NPstmfout.csv")[Sex=="b"]
a=t[,.(year=Year,week=Week,age=rep(1:5,each=.N),dead=unlist(.SD[,5:9]),cmr=unlist(.SD[,11:15]))]
a[,pop:=dead/cmr*100]
a=a[week!=53]
lm=glm(round(dead)~factor(age)+factor(week)+year,offset=log(pop),poisson,a[year%in%2010:2019])
a$base=predict(lm,a,type="response")

p=a[,.(dead=sum(dead),base=sum(base)),.(x=isoweek(year,week,4))]
yearly=p[,.(label=(sum(dead)/sum(base)-1)*100),.(x=as.Date(paste0(year(x),"-7-1")))]
yearly[,label:=paste0(ifelse(round(label)==0,"",ifelse(label>0,"+","")),round(label),"%")]
p=p[,.(x,y=c(dead,base,dead-base),z=rep(1:3,each=.N))]

p[,z:=factor(z,,c("Actual deaths","Baseline","Excess deaths"))]

xstart=as.Date("2015-1-1");xend=as.Date("2025-1-1");p=p[x%in%xstart:xend]
ybreak=pretty(p$y,7);ystart=min(ybreak);yend=max(ybreak)
xbreak=seq(xstart+182,xend,"year");xlab=year(xbreak)

color=c("black","#2266ff","#ff5555")

leg=p[rowid(z)==1,.(x=xstart+60,y=seq(400,,(ystart-yend)/16,.N),label=z)]

ggplot(p)+
geom_vline(xintercept=seq(xstart,xend,"year"),color="gray92",linewidth=.4)+
geom_hline(yintercept=c(ystart,0,yend),color="gray65",linewidth=.4)+
geom_vline(xintercept=c(xstart,xend,as.Date(c("2020-1-1","2015-1-1"))),color="gray65",linewidth=.4)+
geom_line(aes(x,y,color=z),linewidth=.6)+
annotate(geom="label",x=as.Date("2022-7-1"),y=360,label=paste0("Total excess deaths in 2020\nto 2024: ",p[year(x)%in%2020:2024&z==levels(z)[3],round(sum(y))]," (about ",a[year%in%2020:2024,sprintf("%.1f",(sum(dead)/sum(base)-1)*100)],"%\nabove baseline)"),size=4,lineheight=.9,fill="gray90",label.r=unit(0,"pt"),label.padding=unit(4,"pt"),label.size=0,hjust=.5)+
geom_text(data=leg,aes(x,y,label=label),color=color[1:nrow(leg)],size=4.2,hjust=0)+
geom_text(data=yearly,aes(x,y=ystart,label=label),vjust=-.5,size=3.8,color="gray50")+
labs(title="Weekly deaths in New Zealand",x=NULL,y=NULL)+
scale_x_date(limits=c(xstart,xend),breaks=xbreak,labels=xlab)+
scale_y_continuous(limits=c(ystart,yend),breaks=ybreak)+
scale_color_manual(values=color)+
coord_cartesian(clip="off",expand=F)+
theme(axis.text=element_text(size=11,color="black"),
  axis.text.x=element_text(margin=margin(3)),
  axis.ticks=element_line(linewidth=.4,color="gray65"),
  axis.ticks.length.x=unit(0,"pt"),
  axis.ticks.length.y=unit(4,"pt"),
  axis.title=element_text(size=11),
  legend.position="none",
  panel.background=element_blank(),
  plot.margin=margin(5,5,5,5,"pt"),
  plot.subtitle=element_text(size=11),
  plot.title=element_text(size=11.6,face=2,margin=margin(,,4)))
ggsave("1.png",width=6,height=3.5,dpi=300*4)

sub="Source mortality.org/Data/STMF. The percentage above the year shows the total excess deaths on ISO weeks where the Thursday fell on the year. The baseline is a linear trend that is adjusted for seasonality and the population size of age groups. The baseline was calculated by doing a Poisson regression where the age group and week number were included as categorical variables, the year was a continuous variable, and the population size was the offset variable. The age groups used were 0-14, 15-64, 65-74, 75-84, and 85+."
system(paste0("mogrify -trim 1.png;magick 1.png \\( -size `identify -format %w 1.png`x -font Arial -interline-spacing -3 -pointsize $[43*4] caption:'",gsub("'","'\\\\'",sub),"' -splice x80 \\) -append -resize 25% -bordercolor white -border 24 -dither none -colors 256 1.png"))

Faithfull said that after he started keeping records in August 2021, 39 out of the first 40 dead people had been vaccinated within 2 weeks. But he didn't mention if the one remaining person was unvaccinated, or if their vaccination status was unknown, or if they had been vaccinated 14 or more days ago.

So did almost everyone who died due to vaccination die within two weeks from vaccination, so that there were almost no people who died 14 or more days after vaccination? The vaccines were rolled out late in New Zealand, but most people aged 60 and above had already been vaccinated by the start of August 2021, and most people aged 18 and above had been vaccinated by the end of August 2021. But ages 60 and above accounted for about 87% of total deaths in New Zealand in 2021, so presumably ages 60 and above would've accounted for most deaths that were handled by Faithfull's funeral home, and by August 2021, there should've been a lot of people aged 60 and above who had been vaccinated 14 or more days ago.


About two years after the interview with Brenton Faithfull, Matt Shelton told Philip McMillan: "Then we had an embalmer in New Zealand contact us and say, 'Look, I've been keeping a record, and 90% of the deaths that I am working with' - you know, funeral director an embalmer as well - seemed to him to be within - well he was keeping records - they were within two weeks of being vaccinated. So they were predominantly elderly. But they all had this vaccine history, recent vaccine history. And he was finding these clots in the bodies he was embalming." [https://www.youtube.com/watch?v=FFJwkSaIVHE&start=23m16s] But Shelton didn't express any doubt about the validity of Faithfull's statistics, even though they were completely unrealistic.

Nicky Rupright King

Nicky Rupright King tweeted: "Richard Hirschman & I were 2/3 Embalmer's in South AL that came forward after John O'Looney in the UK in reference to the fibrinous clots." [https://x.com/Nickyalembalmer/status/1747807818516754826] O'Looney says that he first learned about the clots from Hirschman's videos, but a lot of people falsely think that O'Looney had started speaking out about the clots before Hirschman. The third embalmer King referred to in her tweet might have been Cary Watkins, who knew Hirschman and who did a short interview with Steve Kirsch in February 2022. [https://rumble.com/vuycmg-embalmer-with-50-years-of-experience-verifies-hirschmans-story.html] In January 2024 King wrote "I can vouch for Richard we have worked together for a few years." [https://x.com/Nickyalembalmer/status/1751830549549719943]

Apart from the footage that was included in Died Suddenly, the only interview of Nicky Rupright King I found was an interview she did with Jason Liosatos in November 2022. [https://www.bitchute.com/video/3Ev4bzcLuj4e/]

At time 3:01, King showed the photo of a green clot below, and she said: "And myself and Richard Hirschman went into the embalming arena, and worked on this gentleman for four hours. And we were able to get some drainage after a lot of work in massage. And this is one of the fibrinous substances and clots that we actually removed from this gentleman." I don't remember other morticians or Hirschman having shown photos of similar green clots (even though King herself said that she had never seen a clot with a similar color before):

Next King said: "This one had little pods attached to it that were almost like a rubber substance. And I - if you look to the right of this, to the right of the one - and it's kind of smushed out onto the table - I actually took my finger and pushed down on that one to pop it to see what was inside of it, and it just had like almost like a granuline substance. Almost as if you see a fatty piece of a steak that had that granule inside of it. And that is the one on the right that you could see draining down on the table." [https://www.bitchute.com/video/3Ev4bzcLuj4e/, 8:26]

Hirschman showed the same photo on Jane Ruby's show in July 2022, when Ruby described the balls attached to the clots as "mysterious ball sacks":

However Hirschman said it was him and not King who popped the ball on the right that had burst open: "Well, on one side of it, on the right side of the screen kind of close to where the table goes down into a little trough for drainage, I was curious too, it's so I took my finger and I started just kind of lightly pressing on it to see if I can break it up. And it did break up and mostly what it seemed like what was coming out of there was like blood, but it still was kind of the strands were still there." [https://rumble.com/v1cfcrx-white-clots-grow-mysterious-ball-sacks-america-is-flying-the-deadly-skies-s.html?start=462] Both Hirschman and King specifically even said that the ball they had burst open was the ball that was draining down on the table.

I didn't find either King or Hirschman mentioning if they worked together to embalm the body with mysterious ball sacks, like how they are supposed to have worked together to embalm the body with the green clots.

But anyway, during the interview with Jason Liosatos, one unusual thing King said was that the white fibrous clots "started happening in 2022 after the vaccines had been out", so I don't know if she accidentally said 2022. [13:12] King said that she had worked together with Hirschman for a few years, but it's not clear if they already worked together in 2021. In 2024 Richard Hirschman said on Twitter that he began noticing strange clotting issues in early 2021 and he took his first photos of the clots in September 2021, but King replied that "I have seen the Clots from the beginning as well, & they continue to become worse". [https://x.com/Nickyalembalmer/status/1861978692051726754]

During the interview with Jason Liosatos, King also said that she was able to tell whether the people she embalmed had been vaccinated based on the consistency of the rubbery clots: "We were at times trying to get a toll on who was vaccinated, who was not, to see if we could see a difference. And most of the time we could tell just by the consistency of the rubbery clots that they were vaccinated. And if I wait on a family and the person is deceased, I will ask, can you please tell me if they had their COVID vaccine? And 9 times out of 10, they've said, yes, they have had the COVID vaccine." [20:03] However she didn't explain how the consistency of the rubbery clots differed between vaccinated and unvaccinated people. Richard Hirschman said that he had seen the calamari clots in only two people who he knew were not vaccinated, but they were both people who had received blood products, so his implication seems to have been that the clots were formed due to some substance that was included in the blood of vaccinated people. So if King also saw the calamari clots in other unvaccinated people who weren't the two people Hirschman mentioned, then did she see the clots when she worked as Hirschman's assistant, or did she also do embalming work on her own without Hirschman? (Or actually it's not clear if by the "consistency of the rubbery clots", she meant that the rubbery clots had a different consistency than non-rubbery clots, so she was able to tell that people with the rubbery clots were vaccinated.)

King also had dramatic story to tell about dead babies, similar to Wesley, John O'Looney, and Brenton Faithfull: "And to speak of fetal demise, after the vaccine had come out, I've seen so many fetal demises. [...] And some of these poor babies were just born so deformed that - things I've never seen in my life before. I felt so bad for these parents who were having to come in and plan for funerals or cremations, memorial services, for their children. From eight months, nine months, to giving birth when they're only - the babies only three months old - the deformities that these children had were astronomical." [24:45]

During the interview with Jason Liosatos, Nicky Rupright King also said: "The time lapse between the people that we know that are vaccinated, because the family will tell us so, and the time of death - you can see a difference in each person as far as this - the size of the fibrinous clots that are growing - you can see if you've been - if in fact they've been vaccinated - let's say two years versus six months - there's a huge difference in the size of these clots. The consistency, the length of them - and as time goes by, we have noticed that they're starting to take route into whatever artery or vein that they're growing in." [37:46] So she seems to have suggested that it might take more than a year for the clots to reach full size, since she said there's a huge difference in the size of the clots between people who were vaccinated 6 months ago or 2 years ago. (Tom Haviland has also suggested that it takes six months or more for the clots to grow, which he said would've explained why morticians only say they started seeing the clots in mid-2021. However what Haviland and King said conflicts with the hypothesis of the endovascular surgeon who sent a letter to McMillan, who speculated that the reason why he wasn't seeing the clots in his patients might have been if the clots formed rapidly right before death.)

Anonymous embalmer interviewed by Pistol Packing Pilot in 2023

In February 2023, a YouTube channel called "Pistol Packing Pilot" posted a two-part interview of an anonymous embalmer. [https://www.youtube.com/watch?v=m29ouzFlkIk, https://www.youtube.com/watch?v=373n_Ymw_mQ] The embalmer sounded like Richard Hirschman whose voice had been slightly pitched up, but I don't know if it was actually him. However Pistol Packing Pilot had done an interview with Hirschman about two months earlier, which I think increases the likelihood that the person who played the role of the anonymous embalmer was actually Hirschman.

The embalmer said that a very good friend of his was a pilot for a US airline, who died from a heart attack caused by clotting. [https://www.youtube.com/watch?v=m29ouzFlkIk&start=10m33s] Pistol Packing Pilot is supposed to be an "Airbus A320 Captain flying for a major U.S. air carrier", and he has done a lot of videos about how airline pilots are supposedly dying from vaccines. It's reminiscent of the stories about dead pilots by Theresa Long, who was a medical officer in the Air Force, so she specialized in stories about how pilots were dying from vaccines.

At time 12:15, Pistol Packing Pilot asked: "Are you still seeing the same number of people who are passing away in their 70s, 80s, 90s? Or is it - you're saying the majority of them are 50s and 60s now?" But the anonymous embalmer answered "Yeah", and he said: "Nowadays it's rare to get someone - I mean, you know, if we do a case and you know, they're 75, 78, 81, something in that nature - that's a shock. Whereas used to - that was the norm, and the younger folks were the shock. Unfortunately, we've gotten to where the number of deaths at a younger age are rising, and that's surprising us. It's - I look for by the end of this calendar year for the number of younger deaths to be more than the number of older deaths. And that is unnatural."

The embalmers who claim to have seen the white clots often also claim that there is an increased number of deaths in younger age groups, but the anecdotal claims are not supported by real mortality statistics. In January 2022 which was the month before the video by Pistol Packing Pilot was posted, the median age of death on CDC WONDER was 76, and about 65% of deaths were in ages 70 and above:

t=fread("https://sars2.net/f/uspopdeadmonthly.csv")
s=t[year==2022&month==1]
s[,median(rep(age,dead))] # 76
s[,sum(dead[age>=70])/sum(dead)] # 0.6494613

The percentage of deaths in ages 70 and above was about 65% in 2019, 2020, and 2022, but in 2021 it temporarily dropped to about 62% (which was probably because the proportion of unvaccinated people was higher in younger age groups than older age groups, and in 2021 there were still many unvaccinated people who had not yet acquired natural immunity):

o=t[,.(dead=sum(dead)),.(year,old=age>=70)]
o=o[,.(oldpct=dead[old]/sum(dead)*100),year]
print(round(o[year%in%2015:2023],1),r=F)
# year oldpct
# 2015   64.8
# 2016   64.0
# 2017   64.7
# 2018   65.1
# 2019   65.3
# 2020   65.1
# 2021   62.5 # low percentage due to young unvaccinated people dying from COVID
# 2022   64.7 # rebound in percentage after unvaccinated people acquire natural immunity
# 2023   65.4

Anonymous embalmer from Ohio whose testimony was published by Laura Kasner

Laura Kasner is Tom Haviland's assistant, who is from Ohio like Haviland. In May 2024 she published a text-only testimony that she supposedly received from a local embalmer from Ohio. [https://laurakasner.substack.com/p/embalmer-testimony]

The embalmer said that he saw the first fibrous clot in March 2021, and that there was a huge increase in deaths in the spring of 2021: "It was then that I began talking with some other of my colleagues and acquaintances that also work in the funeral business. Not only are they seeing these white fibrous structures as well, but every funeral home was INCREDIBLY busy, like off-the-charts record number of new calls. If we usually did 20 calls in the month of April, we did 50. The type of busy that everyone is just trying to keep their heads above water and make sure that families are satisfied with their care. Most funeral homes did about the same number of calls in 2020 as we had in years past, if not maybe a three to five percent increase at most, but if this keeps up, this is the real pandemic."

His claim that there was about 2.5 times the normal number of deaths in April 2021 is inconsistent with actual mortality statistics.

You can go to CDC WONDER: https://wonder.cdc.gov/mcd-icd10-provisional.html. Click "I Agree", switch "Group Results By" to month, and select Ohio as the state of residence. You'll see that Ohio had a fairly low number of deaths in April 2021, because there was a low number of COVID deaths:

d=CJ(year=2018:2024,month=1:12)
d$dead=c(12788,10167,10599,10392,10142,9590,9781,9704,9723,10154,10379,10845,11376,9767,11198,10200,10036,9796,9965,9952,9735,10247,10417,11028,11299,10387,11193,11514,11715,10514,11225,11391,10878,11834,13899,17851,15265,11682,11033,10673,10882,10122,10337,11402,12961,13738,13439,16101,17041,11991,11231,10207,10425,10159,10686,10744,10375,11176,11417,12757,11822,10201,11323,10583,10519,9982,10059,10021,10192,10921,10662,11528,12220,10729,11017,10386,10258,9929,9922,10250,9912,10580,10299,11259)
d$covid=c(rep(NA,26),91,989,1053,466,608,703,557,853,2756,5529,3703,1366,600,556,460,235,164,737,2176,2486,2046,3756,4390,1729,475,148,171,224,302,430,357,303,368,436,428,213,232,159,97,74,33,72,171,174,216,306,304,144,89,57,31,25,72,108,153,97,73,106)

p=d[,.(x=as.Date(paste(year,month,15,sep="-")),y=c(dead,dead-covid),z=rep(1:2,each=.N))]
p[,y:=y/lubridate::days_in_month(x)]
p[,z:=factor(z,,c("All causes","Underlying cause not COVID"))]

x1=as.Date("2018-1-1");x2=as.Date("2025-1-1")
xbreak=seq(xstart+182,xend,"year");xlab=year(xbreak)
y1=0;y2=max(p$y,na.rm=T);ybreak=pretty(c(y1,y2))

ggplot(p,aes(x,y))+
geom_vline(xintercept=seq(x1,x2,"year"),color="gray75",linewidth=.5)+
geom_hline(yintercept=c(y1,y2),linewidth=.5,lineend="square")+
geom_line(aes(color=z),linewidth=.7)+
geom_point(aes(color=z),stroke=0,size=1.3)+
labs(x=NULL,y=NULL,title="CDC WONDER: Monthly deaths in Ohio divided by days in month")+
scale_color_manual(values=c("black","gray60"))+
scale_x_date(limits=c(x1,x2),breaks=xbreak,labels=xlab)+
scale_y_continuous(limits=c(y1,y2),breaks=ybreak)+
coord_cartesian(clip="off",expand=F)+
theme(axis.text=element_text(size=11,color="black"),
  axis.text.x=element_text(margin=margin(4)),
  axis.ticks=element_line(linewidth=.5),
  axis.ticks.length=unit(3,"pt"),
  axis.ticks.length.x=unit(0,"pt"),
  legend.background=element_rect(fill="white",color="black",linewidth=.5),
  legend.box.spacing=unit(0,"pt"),
  legend.direction="vertical",
  legend.justification=c(1,1),
  legend.key=element_blank(),
  legend.key.height=unit(12,"pt"),
  legend.key.width=unit(30,"pt"),
  legend.margin=margin(5,7,5,5),
  legend.position=c(1,.4),
  legend.spacing.x=unit(3,"pt"),
  legend.spacing.y=unit(0,"pt"),
  legend.text=element_text(size=11),
  legend.title=element_blank(),
  panel.background=element_blank(),
  panel.border=element_rect(fill=NA,size=.5),
  plot.margin=margin(5,5,5,5),
  plot.title=element_text(size=11.5,face="bold",margin=margin(,,5)))
ggsave("1.png",width=6,height=2.5,dpi=300*4)

The anonymous embalmer also had a dramatic story to tell about dead babies: "We also saw an exponential increase in the number of fetal and infant deaths in 2021. From 2015-2020, you could count on one hand how many fetal deaths we had. It's not something that is very common. But in 2021, we had more than 10 fetal deaths in less than a year. We also had deaths in several month-old babies that were otherwise perfectly healthy. The family chalked it up to SIDS, but we found out later that the breastfeeding mother was given her Covid vaccine just days prior to the death of the infant. And she wasn't the only one that this happened to. 100% of the fetal and infant deaths that occurred in 2021 were born to vaccinated mothers. There were so many red flags occurring that we began asking every single family that we met with whether the deceased (or the mother of the infant) had previously had Covid or whether they had taken the Covid vaccination. We found that the bodies that had these weird clots inside them - about half of them previously had Covid, but 100% were vaccinated."

However according to CDC WONDER, there was a low number of fetal deaths in Ohio in 2021: [https://wonder.cdc.gov/fetal-deaths-expanded-current.html]

New Zealand mortician Diane whose testimony was published by NZDSOS

In December 2024, NZDSOS published a text-only testimony of an anonymous mortician who they gave the pseudonym Diane. [https://x.com/nzdsos/status/1867008577610846319] She said she saw calamari clots in about 1 in 3 embalmings.

She said that she started to work in the funeral industry over a decade ago, but in the years before COVID, she had only dealt with two unexpected deaths in people under the age of 70. But now after the vaccine rollout, she said that "the number of sudden deaths is up sharply, the youngest person that I had to take care of was only 21 years (died while getting ready to play rugby, fit and healthy). Sudden deaths are spread across all ages and are showing no signs of slowing down."

According to the mortality statistics published by Statistics New Zealand, there hasn't been any major increase in deaths in younger age groups since the vaccine rollout (even though I don't know how to find statistics specifically for "sudden deaths"): [https://infoshare.stats.govt.nz]

agecut=\(x,y)cut(x,c(y,Inf),paste0(y,c(paste0("-",y[-1]-1),"+")),T,F)

t=fread("http://sars2.net/f/nzpopdead.csv")[year>=2010]
a=t[,.(dead=sum(dead),pop=sum(pop,na.rm=T)),.(year,age=paste("Age",agecut(age,0:4*20)))]
a=rbind(a,a[,.(dead=sum(dead),pop=sum(pop),age="All ages"),year])

p=a[,.(x=year,y=dead/pop*1e5,age)]
p=p[,cbind(.SD,predict(lm(y~x,.SD[x<2020]),.SD,interval="prediction",level=.95)),age]

p=merge(p,p[,.(ymax=max(y)),age])

xstart=2010;xend=2024;xbreak=seq(xstart,xend,1)
color=c("black","#3333ff","#3333ff")
lab=c("Mortality rate","2010-2019 linear trend (with 95% prediction interval)")
lab=factor(lab,lab)

ggplot(p,aes(y=ymax))+
facet_wrap(~age,dir="v",ncol=2,scales="free_y")+
geom_vline(xintercept=seq(xstart-.5,xend,5),color="gray80",linewidth=.4)+
geom_ribbon(aes(x,ymin=lwr,ymax=upr),fill=color[3],color=color[3],alpha=.2,linewidth=.3)+
geom_line(aes(x,y,color=lab[1]),linewidth=.6)+
geom_line(data=p[x<2020],aes(x,y=fit,color=lab[2]),linewidth=.6)+
geom_line(data=p[x>=2019],aes(x,y=fit),color=color[2],linetype="11",linewidth=.6)+
geom_point(aes(x,y,color=lab[1]),stroke=0,size=1.5,show.legend=F)+
geom_text(data=p[rowid(age)==1],aes(label=age,x=xstart,y=ymax/2),hjust=0,size=grid::convertUnit(unit(11,"pt"),"mm"),fontface=2)+
geom_text(aes(x,y=0,label=round((y/fit-1)*100)),size=3.5,vjust=-.4,color="gray55")+
labs(title="Yearly deaths per 100,000 people in New Zealand",subtitle="Source: infoshare.stats.govt.nz. Excess death percent is shown in gray.",x=NULL,y=NULL)+
scale_x_continuous(limits=c(xstart-.5,xend+.5),breaks=xbreak)+
scale_y_continuous(limits=c(0,NA),breaks=\(x){y=pretty(x,5);y[y<.95*max(x)]},labels=\(x)ifelse(x>=1e3,paste0(x/1e3,"k"),x))+
coord_cartesian(clip="off",expand=F)+
scale_color_manual(labels=lab,values=color)+
theme(axis.text=element_text(size=11,color="black"),
  axis.text.x=element_text(margin=margin(3),angle=90,vjust=.5,hjust=1),
  axis.ticks=element_line(linewidth=.4,color="black"),
  axis.ticks.length.x=unit(0,"pt"),
  axis.ticks.length.y=unit(3,"pt"),
  legend.background=element_blank(),
  legend.box.spacing=unit(0,"pt"),
  legend.justification="left",
  legend.key=element_blank(),
  legend.key.height=unit(13,"pt"),
  legend.key.width=unit(25,"pt"),
  legend.margin=margin(,,5),
  legend.position="top",
  legend.spacing.x=unit(2,"pt"),
  legend.text=element_text(size=11,vjust=.5),
  legend.title=element_blank(),
  panel.background=element_blank(),
  panel.border=element_rect(fill=NA,linewidth=.4),
  panel.spacing.x=unit(3,"pt"),
  panel.spacing.y=unit(4,"pt"),
  plot.margin=margin(5,5,5,5),
  plot.subtitle=element_text(margin=margin(,,3)),
  plot.title=element_text(size=11.3,face=2,margin=margin(2,,4)),
  strip.background=element_blank(),
  strip.text=element_blank())
ggsave("1.png",width=5.7,height=4.2,dpi=300*4)
system("mogrify -resize 25% -dither none -colors 256 1.png")

Diane also said that she saw lots of turbo cancer, and she made the unrealistic claim that the majority of cancer deaths now occurred within 3 months from the first cancer diagnosis:

The other noticeable difference is in cancer: much more but especially in the young.

Before the vax, my observations were that the time between the first diagnoses and death was at least a year minimum (there were some exceptions), now the majority are less than 3 months.

I looked after a younger person not so long ago, the time between diagnoses and death was 4 days..... there are no words......

Similar to many other morticians in alt media, she also had a dramatic story to tell about dead babies:

Then the dramatic increase in late term miscarriages, and still births, was very obvious.

For example, we usually took care of up to three babies within a two-month period, (which is already too many; one of the hardest aspects of the job). The first week of the vax, we had three babies born dead in the same week!

Were these partners of vaccinated border workers? I don't remember the 'safe in pregnancy' message being pushed until after that.

However based on data from Statistics New Zealand, there hasn't been any massive increase in stillbirths since the vaccine rollout: [https://infoshare.stats.govt.nz/ViewTable.aspx?pxID=37ba9dc1-91dd-4470-a605-060ded2c70d3]

t=fread("http://sars2.net/f/nzstillbirth.csv")[year>=2000]

t=cbind(t,predict(lm(stillbirths~year,t[year<2020]),t,interval="prediction",level=.95))

leg=c("Rate per 100,000","2000-2019 linear trend","95% PI")
col=c("black","#0000ff","#8888ff")

p=t[,.(x=year,y=c(stillbirths,fit),z=factor(rep(1:2,each=.N),,c("Stillbirths","2000-2019 linear trend")))]

xstart=2000;xend=2023;xbreak=seq(xstart,xend,2)
ylim=c(0,max(t[,c(stillbirths,upr)]));ybreak=pretty(ylim,7)

color=c("black","#3333ff");lab="95% prediction interval"

ggplot(p)+
geom_ribbon(data=t,aes(x=year,ymin=lwr,ymax=upr,fill=lab),color=color[2],alpha=.2,linewidth=.3)+
geom_line(data=p[!(z%like%"linear"&x>=2020)],aes(x,y,color=z),linewidth=.6)+
geom_line(data=t[year>=2019],aes(x=year,y=fit),color=color[2],linetype="42",linewidth=.6)+
geom_point(aes(x,y,color=z,alpha=z),stroke=0,size=1.5)+
labs(title="Yearly stillbirths in New Zealand",x=NULL,y=NULL)+
scale_x_continuous(limits=c(xstart-.5,xend+.5),breaks=xbreak)+
scale_y_continuous(limits=ylim,breaks=ybreak)+
coord_cartesian(clip="off",expand=F)+
scale_color_manual(values=color)+
scale_fill_manual(values="#3333ff")+
scale_alpha_manual(values=c(1,0,0))+
theme(axis.text=element_text(size=11,color="black"),
  axis.text.x=element_text(margin=margin(3)),
  axis.ticks=element_line(linewidth=.4,color="black"),
  axis.ticks.length=unit(3,"pt"),
  axis.title=element_text(size=8),
  legend.background=element_blank(),
  legend.box.spacing=unit(0,"pt"),
  legend.key=element_blank(),
  legend.key.height=unit(13,"pt"),
  legend.key.width=unit(25,"pt"),
  legend.position="top",
  legend.justification="left",
  legend.spacing.x=unit(2,"pt"),
  legend.margin=margin(,,6),
  legend.text=element_text(size=11,vjust=.5),
  legend.title=element_blank(),
  panel.background=element_blank(),
  panel.border=element_rect(fill=NA,linewidth=.4),
  plot.margin=margin(5,5,5,5),
  plot.title=element_text(size=11.3,face=2,margin=margin(2,,4)))
ggsave("1.png",width=6,height=3.5,dpi=300*4)

Lorin Ware and Bill on VSRF embalmer panel in 2024

In 2024 Steve Kirsch hosted a video panel about the clots, which featured Tom Haviland, Richard Hirschman, and two embalmers called Lorin Ware and Bill who I haven't seen appear elsewhere in alt media. [https://rumble.com/v4calhh-vsrf-live-113-embalmer-data-revealed.html]

Bill said this about the clots: "Prior to this - I mean, I've been an embalmer over 30 years - I had never ever seen this - prior to, I'm gonna say July or August of 2021." [31:12] Kirsch also asked Lorin Ware: "And you started seeing them in mid-2021?" But she answered "Yes sir", and then Kirsch asked "Was it like a light switch turning on, or did it happen pretty gradually?" And she answered that "It was like a light switch turning on." [26:00] But if embalmers started suddenly seeing the clots in mid-2021, then how come no-one was speaking out about the clots until January 2022?

Later Kirsch asked Bill: "What percentage of the cases that you embalmed are - do you believe are due to, uh - we're killed by the vaccine?" [1:03:11] And Bill replied: "I would say over 90%." And Kirsch said: "Wow. Wow. Ok. That's a showstopper." And then Kirsch asked: "Um, so, so Bill, the 90%: how confident are you?" [1:05:21] But Bill answered "100%". And Kirsch asked "100% confident?" And Bill replied: "I am. I can, I guarantee you, I can show you every single person that's been vaccinated."

Bill was supposed to be a trade embalmer, so how would he even know the vaccination status of the people he embalmed, let alone their cause of death? He said that he worked with multiple funeral homes within a 60-mile area, so did he ask the staff at all the funeral homes to find out the vaccination status and cause of death of the people he embalmed? Was the staff really willing to bother the family members to ask them questions that a funeral home would not normally need to ask? And were they able to find the cause of death with enough certainty that Bill could be 100% sure that 90% or more of the deaths were due to the vaccine? Or was he just sure about it because he saw calamari clots in the bodies he embalmed, and he assumed that people with the clots died from the vaccine?

Later during the same interview, Hirschman said: "I don't get the vaccine status because I'm the trade embalmer. Whether the funeral director wants to ask the family is up to them. We had one recently - there's one funeral director I know and an embalmer - she was pretty blunt, you know, she just asked the family. And the family asked her 'Was that necessary to ask for the death certificate?' And she says, 'No, I was just was curious.'" [1:57:36] Hirschman's explanation seems reasonable, because the family members would indeed be asking why they need to tell the funeral home about the vaccination status or death certificate of the deceased person.

Anna Foster

I believe Anna Foster was the second mortician after Hirschman who said they had seen calamari clots, because her interview with Kirsch was published about 2 weeks after Hirschman's first interview with Jane Ruby.

I found only one other interview that Anna Foster did later on, which was an interview Chris Martenson did with her and Richard Hirschman.

During the interview, Martenson asked: "These fibrous things we're talking about - the calamari - are these coming out of both veins and arteries?" And then Hirschman replied "Yes." And Martenson asked: "Even-steven?" And Hirschman said "Yes, exactly." Then Foster said: "I've only gotten them out of the veins - out of the vein. I haven't seen the arteries." [https://rumble.com/v25vb6u-embalmers.html?start=1500]

So if Foster said she only saw the clots in veins, it seems like a major inconsistency compared to what other morticians are saying.

Embalmer John McGhee who was a member of Scientology and Anonymous

In December 2022, a BitChute channel called Off-Grid Ireland published an interview with the Irish embalmer John McGhee. [https://www.bitchute.com/video/0FudnOuCryag/, https://transcriberb.dreamwidth.org/194510.html]

McGhee said he found the clots in arteries: "In the arteries I'm finding the clots which you were seeing in that movie, Died Suddenly." [8:28] But he didn't specify if he also found the clots in veins. He also made it clear he had not seen similar type of clots earlier: "But the clots that are forming now are made of - not composed of blood. That's the thing, that's what's not common. And the consistency and the size - it's just like something that's never been experienced before." [23:14]

Normally in the case of clots that occur in living people, white clots are more common in arteries and red clots are more common in veins. So it made sense to McGhee to say that he only saw the new type of white clots in arteries. But other embalmers like Hirchman say that calamari clots are approximately equally common in arteries and veins. And Anna Foster said that she only saw calamari clots in veins but not arteries. [https://rumble.com/v25vb6u-embalmers.html?start=1500]


The STAND League is Scientology's equivalent of the ADL, which maintains dossiers on critics of Scientology. The STAND League's page about John McGhee said: [https://www.standleague.org/hate-monitor/exposed/john-mcghee.html]

John McGhee was marginally involved as a parishioner of the Church of Scientology Mission of Dublin beginning in 2005, participating in a few introductory services. He was expelled from the Church in 2009 after joining the cyberterrorist group Anonymous.

[...]

For the last two years of his association with Scientology, while pretending to be a member of the Church, McGhee secretly was connected to anti-Scientologists, including members of Anonymous.

In 2009, McGhee's participation in this cyberterrorist group was exposed when he joined hate marches and so-called "flash raids" against Scientology Churches in England.

While attacking the Scientology religion, he also posted on the Internet a picture of himself having desecrated a Christian cemetery - hanging an Anonymous mask on a gravestone.

Even though the STAND League said that McGhee only participated in a few introductory services, another article said that he spent about 18,000 GBP on services of the Church of Scientology. [https://culteducation.com/group/1284-scientology/24594-the-holocaust-wasnt-nazis-it-was-psychiatrists-says-cult-leader-david-miscavige-as-the-sun-goes-inside-the-sinister-uk-lair-of-scientology.html]

A video by McGhee was posted on the YouTube channel of Anonymous Hamburg, which is focused on anti-Scientology content. In the video McGhee said: "I started hooking up with the Anonymous guys and other anti-Scientology activists, and I was feeding information out to those guys. I was spying on the mission basically." [https://www.youtube.com/watch?v=cawOt8ZAGIE&start=9m51] However a blog post from 2016 said that some ex-Scientologists believed that John McGhee was working as a double agent for Scientology. [https://dialogueireland.wordpress.com/2016/04/26/bad-day-for-the-scientologists-ex-scientologists-understanding-cultism-and-common-sense/]

A document I found on Scribd said: "Cathy Schenkelberg, 60, is romantically linked to the Irish extremist and embalmer Sean Paedric MacAoidh a/k/a John McGhee. Irish authorities maintain a dossier on MacAoidh, Schenkelberg, and their associates." [https://www.scribd.com/document/444266008/Cathy-Schenkelberg-Bankruptcy-Papers] Schenkelberg is also an anti-Scientology activist.

The name Schenkelberg doesn't sound too Irish, but as a matter of fact, it appears to be an ethnic German surname that is not common among Jews. In order to estimate how likely a surname is to be Jewish, you can go to Forebears.io and check if the name is common in Israel relative to other countries, but the name Schenkelberg has an estimated incidence of zero in Israel. [https://forebears.io/surnames/schenkelberg]


When I searched BitChute for early videos about graphene oxide, one of the earliest videos I found was posted by a channel called "Anon Research Group". The video said that graphene oxide explained why vaccinated people were magnetic, and that masks and COVID test kits contained graphene oxide, and that graphene poisoning caused symptoms similar to COVID: [https://www.bitchute.com/video/ezKdZPcNGrCu, https://www.bitchute.com/search?query=graphene+oxide&sort=old]

One of the most popular conspiracy accounts on Twitter is illuminatibot, which posts tweets from the same pool as other accounts linked to the IlluminatiCoin cryptocurrency, like thehealthb0t, ufob0t, 0ccultbot, conspiracyb0t, and redpillb0t. They are part of a network of bot accounts called the "trutherbot" operation, which used to originally consist of accounts with Guy Fawkes avatars. [illuminatibot.html] A user who is featured on IlluminatiCoin's Twitter spaces posted an image that said "#TrutherBotArmy is a splinter group of #Anonymous". [https://x.com/yruidjits/status/1258520312393510913] The illuminatibot account has promoted Stew ops about hydras, graphene nanobots, hydrogel, and calamari clots:

Perhaps Anonymous was set up to act as controlled opposition to Scientology. Anonymous was kind of like a proto-Q, or at least the brand of Anonymous was hijacked by the same kind of information operatives who later rebranded themselves as Qtards. IlluminatiCoin's LinkTree page has a link to a profile of someone called "Operation Q", who was one of the authors of a Q blog called Humorous Mathematics. [https://linktr.ee/illuminaticoin]


Added in June 2025: Richard Hirschman now posted a video by John McGhee: [https://x.com/r_hirschman/status/1935080376247971988]

People who claim to have seen the clots in living people

I can think of 4 or 5 people who have provided first-hand testimony that they have seen calamari clots inside the body of a living person:

There's a lady called Melanie who says that she saw calamari clots being formed in a surgical drain tube that was attached to her body, but I didn't include her on my list because she didn't see the clots directly inside her own body. (And she clearly mistook regular fibrin clots for calamari clots, and she hadn't had an opportunity to see what kind of clots formed in surgical drain tubes before 2021, so she wasn't able to tell if the clots she saw were a novel type of clots or not.)

Soon after Philip McMillan was contacted by his cath lab whistleblower, Tom Haviland said that he had been contacted by another cath lab whistleblower, and Haviland showed photos by the whistleblower that were also posted on Twitter by John O'Looney. Haviland later revealed that the whistleblower's name was Mohannad Bisharat. But I didn't include Bisharat on my list above because I didn't find first-hand testimony by him anywhere.

Leunis van Rooyen

After the anonymous ER doctor who was interviewed by Mike Adams on InfoWars through a voice changer, the second earliest person I have found who claimed to have seen a calamari clot in a living person is Leunis van Rooyen, who was interviewed by Jane Ruby in September 2022. [https://rumble.com/v1kcwtl-live-7pm-white-clots-pulled-from-the-living.html] Jane Ruby said that van Rooyen was a member of a team of surgeons who had removed a calamari clot from the leg of a living person. But he is an alternative medical practicioner whose PhD degree is in natural medicine, so he doesn't seem like someone who would be performing surgery. [https://tailorblend.co.za/Web/Practitioner/Details/6620]

When Jane Ruby asked van Rooyen about snake venom, he said that COVID vaccines induce the human body to produce toxic proteins similar to how snakes produce snake venom: "What happens is that the gain of function genetic therapy causes the body to produce proteins which would be toxic to the body. So I try and imagine for myself being born with some type of a function similar to having glands like a snake, and then these glands produce the protein. So in this case, it's just through the metabolic process. So I'm born then with a protein that's - like snake poison is protein, if a spider bites is it's a protein, the same with the most toxic animal we know of - or it's a snail in the sea - and that protein is deadly. So I'm born with this protein produced in my own body by myself to toxify myself. And this is not good at all. Besides this injection, this jab also - professor Dr. Andreas Noack made mention of the graphene hydroxide, which we would like to investigate from the samples we've got from these so-called blood clots or nylon ropes - I would like to subject it now to a mass spectrometer to see if we can see these graphene hydroxide." [20:41] By the term "nylon ropes", van Rooyen referred to calamari clots.

Next van Rooyen showed microscope images taken by Zandre Botha, who is an alternative medical practicioner from South Africa. In 2021 Zandre Botha showed Stew Peters photos of self-assembling discs she found in a vaccine vial, and in 2022 she showed Jane Ruby photos of snake venom peptides in COVID vaccines. [https://rumble.com/v24zioe-blood-doctor-reveals-horrific-findings-dr.-zandre-botha-and-stew-peters-10-.html, https://rumble.com/v11zh8o-first-pictures-and-videos-of-snake-venom-peptides-in-bioweapon-shots.html]

First van Rooyen showed the photo below, and he said "From this nylon rope I received, I requested that Dr. Zandre to take me into a laboratory and we would look in their microscope at some cells from this. We saw the cells being damaged and typically what I would expect a cell would look like being poisoned from snake": [27:24]

Next he showed these photos, which supposedly showed Zandre Botha's own blood cells before and after exposure to a COVID vaccine (which is similar to McCairn's stunt that was paraded around the alt media by Richard Fleming):

At time 31:46, van Rooyen said that COVID vaccines induce the production of amyloid fibrin microclots, which might turn humans into zombies. Then he said: "So the CDC, Center for Disease Control, devoted the last section on the website to this - talking about the zombie apocalypse. So it's not me saying that. I just repeat what they say." Then Jane Ruby said "Unbelievable."


In another video, Jane Ruby said that another member of van Rooyen's group of surgeons was Herman Edeling: "In South Africa we talked with Leunis van Rooyen, who is a naturopathic doctor. But he works with a team of surgeons - they're all part of a group - with Dr. Herman Edeling, who's an attorney, and a former neurosurgeon." [https://rumble.com/v1o1qe8-horror-embalmer-finding-fibrous-clots-in-vaxxed-corpses.html?start=192] Van Rooyen and Edeling also appeared together as guests on Jane Ruby's show. [https://rumble.com/v1la8k5-live-7pm-new-treatment-for-the-jabbed.html] I don't know if Edeling is supposed to have taken part in the clot surgery. Edeling is the leader of a group called SAVIMS (South Africa Vaccine Injury Medico-Legal Study-Group). Founding members of SAVIMS include Leunis van Rooyen, Zandre Botha, Shankara Chetty, and Nick Hudson. [https://savims.org.za/wp-content/uploads/2025/02/0101-Cardiac-Related-Mortality-Following-COVID-19-Vaccination-in-Florida.pdf]


When I searched for old tweets that matched the name "Leunis van Rooyen", the earliest COVID-related tweet I found was posted by an account that promotes Miles Guo, and the tweet referred to van Rooyen's interview with Jane Ruby: [https://x.com/2222karen2222/status/1570393300867350531]

Anonymous cath lab whistleblower interviewed by Philip McMillan

In February 2024 Philip McMillan claimed that he had been contacted by an anonymous whistleblower who worked at a catherization laboratory, where he had removed calamari clots from the bodies of living people.

McMillan did an audio-only interview with the whistleblower, who said: "But this new white clot issue - which I compare them to calamari or rubber bands, very strong rubber bands that cannot be pulled apart - this phenomenon has started in, um, late 2021. And we have pictures as early as early 2022." [https://philipmcmillan.substack.com/p/are-the-embalmers-clots-occurring, 7:07] It seems unusual how he said he only started to see the clots in late 2021, even though the morticians usually say they started seeing the clots in mid-2021 or early 2021.

The whistleblower said: "We have about 20 on staff - nurses, anesthesiologists, vascular surgeons, radiologists, and, uh, cardiologists - have all witnessed this." [7:58] But if there are several types of specialists who work at cath labs who are seeing the clots, then why are there so few people speaking out about the clots?

McMillan's video also featured his sidekick Dr. Shankara Chetty, who said: "When we looked at this initially with Mr. Hirschman, I think it was, I was considering whether this is something to do with the hydrogel that's used - hydrogels have been used as tissue clues, that kind of thing for a long time. And I think we need to look at the research around hydrogels and how they interact with other things. Because this - this is not - this is not natural. So it's got something to do with, whatever, I mean, or whatever the nanotechnology that's being used - or the hydrogels, the lipid nanotechnology." [21:52] Karen Kingston and David Nixon also say that the calamari clots are made up of hydrogel, and Sasha Latypova told Jane Ruby that hydrogel is probably incorporated into the clots. [https://karenkingston.substack.com/p/millions-of-self-assembling-nanotech, https://davidnixon.substack.com/p/hydrogel-gelplastic-and-rubbery-clots, https://www.bitchute.com/video/6wSCNCHm1dUa/, 40:45]

At time 16:12, McMillan showed the photo below and asked: "And was this one of the very stretchy rubbery-like clots?" And the whistleblower said "Yes sir." But the clot is not even white, and the clot doesn't even look like it would turn white if it was washed of blood:

At time 17:15, the whistleblower showed this photo and said: "That is a lower-leg extremity DVT blood clot. But the reason why they might appear normal - although this one doesn't, the last one did - it's pulled directly from the patient - which still is coated in blood."

Next the whistleblower showed the photo of a pulmonary embolism below. Then McMillan said: "Now saddle PE's, I mean, they do occur. So it's not as if they don't occur. What about this would have made you concerned?" And the whistleblower asked: "As far as what, can you repeat?" And McMillan said: "So was it just a bigger clot or is it actually seeing multiple saddle PE's far more than you would normally?" And the whistleblower answered: "Yes. We have a big increase on our numbers when it comes to saddle PE. We used to maybe get one every couple of months. Now we're getting a couple every week." So it's not even clear if the whistleblower was saying that the clot he showed was a new type of white clot or not, or if he just it was a regular clot but what made it unusual was that he was now seeing regular clots more often than earlier:

The whistleblower's photo of a pulmonary embolism doesn't look too different from regular pulmonary embolisms:

The whistleblower also showed the next clot, but it looks red like a normal blood clot, and it doesn't really look like it would turn white even if it was washed of blood:

When McMillan showed the clot below, he circled the part I highlighted, and he asked "Now this again was the white fibrous bit?" And the whistleblower replied "Yes sir." The clot also has a couple of other similar lighter bits, but all of the lighter parts are very small compared to the clots Hirschman has shown. The middle and right clots also look very wide, because they are about 3 inches at the widest part (or I don't know if they're really even blood clots, because they look more like strawberry jelly):

The whistleblower also showed a couple of other clots, but all of them just looked like regular red clots. Couldn't he at least have shown photos of the clots before and after washing them of blood? Then it would've been clearer if the clots were actually white or not.


In January 2024 when McMillan interviewed Haviland, McMillan said: "One of the questions I had was that if the big clots are being formed, I would expect that we would see it on angiograms. And so this is why I had always thought that it occurs primarily, not necessarily exclusively, postmortem. [...] If it was causing that much damage, it's difficult to imagine that we wouldn't be seeing it clinically. So I'm trying to get my head around it." [https://www.youtube.com/live/S4Q-vW1tWyo?t=28m32s] Which was a good point. But then over the next few months, there was an influx of new people who claimed to have seen calamari clots in living people, and who were connected to either McMillan or Haviland. In February 2024 McMillan did a video with the cath lab whistleblower, in March 2024 McMillan announced that Haviland had also been contacted by his own cath lab whistleblower, and in May 2024 Phillip Triantos said on McMillan's show that he had seen calamari clots on MRI and CT scans. But I can think of only two people who had said before 2024 that they had seen calamari clots in living people, who are the anonymous ER doctor who was interviewed by Mike Adams through a voice changer, and Leunis van Rooyen.


The Substack author Bill Rice estimated that there would be approximately 20,000 health care professionals in the US who work at cath labs so they would be aware of the clots, and he wrote: [https://billricejr.substack.com/p/stunning-claims-of-whistleblower]

This whistleblower - a trained expert in removing blood clots - has been seeing these clots since late 2021, which means he and others at his hospital have now been seeing these brand new white fibrous substances for almost 2 1/2 years.

In other words, for at least 30 months, none of these approximately 20,000 health care professionals in America reported what they are (presumably) seeing to the public.

Another question that occurs to me - that was not asked in the interview - is whether any of the surgeons or lab techs ever notified the patients that the clots they had removed from their veins or arteries were not "normal" and were, almost certainly, created by the Covid vaccines they'd received.

In other words, there should be thousands of patients who were notified of the strange substances that threatened their lives. Were these patients, in fact, notified of this? If not, why not? If some patients were notified of this, why haven't they come forward and reported this to the public?

Rice brought up a good point, when he said that hospitals would notify patients that they had a new type of abnormal clot removed, so you'd expect there to be patients who are speaking out about having had a novel type of clot removed. But I don't know of a single such patient.

An article from 2006 estimated that "4.21 million patient cases were performed at 1,970 cardiac cath lab sites in 2006". [https://healthimaging.com/topics/medical-imaging/diagnostic-screening/us-cardiac-cath-lab-investment-continues?utm_source=chatgpt.com] A study from 2024 said that there were about 3,000 board-certified vascular surgeons in the United States, but the figure didn't include other staff at vascular surgery labs. [https://www.annalsofvascularsurgery.com/article/S0890-5096%2824%2900559-4/abstract]

Tom Haviland's cath lab whistleblower Mohannad Bisharat

In June 2024 Tom Haviland and John O'Looney published photos that supposedly came from an anonymous whistleblower, who worked as a surgeon at a catheterization laboratory where he removed clots from living people.

John O'Looney posted this tweet about the photos: [https://x.com/OlooneyJohn/status/1797976412860629014]

O'Looney described the clots as "white fibrous clots", even though the clots look more like red. I don't know if the clots would be white if they were washed of blood, but the clots look similar to regular red clots removed by endovascular surgeons.

In one video, O'Looney said: "When it comes out, it has blood on it and it's red. But it's not a blood clot. When it's washed off, you can see it's clear, and it's white." [https://rumble.com/v1c8w03-john-olooney-hospitals-are-covering-up-baby-deaths-by-cremating-babies-them.html?start=464]

One of the clots shown by the whistleblower looks like a saddle pulmonary embolism, where the tree-like segments on the sides were formed in the left and right pulmonary arteries, and the segment in the middle was formed in the main pulmonary artery that connects the lungs:

But even though the whistleblower's clot is supposed to be a novel "white fibrous clot", it doesn't look too different from a normal pulmonary embolism, like this clot I found on Google Images: [https://www.linkedin.com/posts/farah-al-khitan-533295103_inari-activity-6866910642872336384-75Ki]

In February 2023, which was over a year before the photos were posted by O'Looney in June 2024, Ryan Cole showed one of the photos on Dr. Drew's YouTube channel. Cole said that the clot on the left was removed from a living patient but the clots on the right were clots from dead bodies: [https://www.youtube.com/watch?v=sxKO2XkkoGg&start=29m54s]

The photos by the cath lab whistleblower were posted on Substack by Laura Kasner. She said that Tom Haviland recently received the photos "from a cardiologist who works in a cath lab", and she said that this photo that had earlier been shown by Ryan Cole showed an "illiac artery clot removed from the pelvis of a living person": [https://laurakasner.substack.com/p/the-clots-are-still-being-found-a]

Laura Kasner wrote: "Note that these clots appear red. That is because they had just been removed from LIVING persons. These clots are WHITE when rinsed off and look just like the clots being pulled out of the deceased." But the whistleblower should've also shown photos of the clots after the clots were washed of blood, so people could've seen if the clots were truly white or not.

And why would the same type of clots even look red when they are pulled out of living people but white when they are pulled out of dead people? For example here's one video where Hirschman supposedly pulled out a calamari clot from a dead body, but the clot already had a near-white color as it was being pulled out of the body, even though the clot was pulled out of an incision that was filled with blood: [https://x.com/r_hirschman/status/1921293864637239781]


Added in July 2025: Haviland now said that his whistleblower was someone called Mohannad Bisharat: "In March of last year, in 2024, I was actually introduced by an OBGYN in Jacksonville, Florida, Dr. Dan McGuire, to this gentleman, a Dr. Mohannad Bisharat, who's an endovascular specialist and cardiologist in Jacksonville, Florida. And he admitted to me in communication that he's been removing these same white fibrous clots from living people for the last four years. He actually calls them 'devious clots.'" [https://rumble.com/v6wvcn8-clot-coverup-from-cv19-vax-tom-haviland.html?start=197]

Mohannad Bisharat has also posted photos of clots on his LinkedIn profile, but I didn't see him mentioning any of the clots would've been a novel type of clots that he didn't see before 2021. The clots in his photos had a similar red color as the supposedly novel clots that were shown by Cole, O'Looney, and Haviland: [https://www.linkedin.com/in/mohannad-bisharat-6b3217118/]


Haviland later wrote: "In March 2024, I was contacted by Dr. Dan McDyer, an OB/GYN in Jacksonville, Fl who has seen 'carnage' in his own practice due to the Covid vaccine. Dr. McDyer introduced me to Dr. Mohannad Bisharat, a Cardiologist/Endovascular Specialist (also in Jacksonville) who has been pulling these same 'devious' clots (in his words) out of LIVING PEOPLE (see attached email thread)." [https://laurakasner.substack.com/p/my-phone-call-with-nih-director-dr]

McDyer tweeted photos of Bisharat's clots in January 2024, which was before the photos had been presented by Haviland or O'Looney: [https://x.com/drmcdyer1/status/1747117781395403170]

Dan McDyer's banner image on Twitter is a photo where he poses together with Ryan Cole and Pierre Kory. I believe Cole was the first non-mortician who claimed to have seen the calamari clots, and in January 2022 soon after Jane Ruby had first broken the news about the clots, Pierre Kory sent a text to Kirsch about the clots and connected Kirsch with Hirschman. [https://kirschsubstack.com/p/worldwide-exclusive-embalmers-find] McDyer has appeared in videos by SPN, CHD, VSRF, and We The Patriots USA, which I think are all controlled opposition. [https://rumble.com/search/video?q=%22dan+mcdyer%22&sort=date]

Dan McDyer was also one of the 13 authors of a paper published in IJVTPR titled "Menstrual Abnormalities Strongly Associated with Proximity to COVID-19 Vaccinated Individuals", where the other authors included James Thorp, Brian Hooker, Christiane Northrup, and Raphael Stricker. [https://ijvtpr.com/index.php/IJVTPR/article/view/113/365] Brian Hooker is a member of the editorial board of IJVTPR. Northrup wrote the foreword for a book by the Chabadnik UFO cult leader Jason Shurka, who claims that his mentor was taken to an extraterrestrial planet called Nashia by a 424-year-old rabbi. [https://web.archive.org/web/20220721002713/https://unifyd.tv/wp-content/uploads/2021/08/Rays-of-Knowledge-PDF.pdf] Raphael Stricker is possibly the main person who popularized the Morgellons disease hoax.


In May 2022 Ryan Cole said: "I've been in contact with several - well, pathology colleagues, coroners, and embalmers. And the embalmers - they were noticing that when they were going to put the embalming fluid in, they were getting back pressure that they had never seen before. And they started pulling out these long congealed clots. And, you know, 6 inches long, 12 inches long, 4 feet long. I was talking to a surgeon in Florida this week, and he had pulled out two several-foot long clots from a patient I know - several patients who hand long brachial clots." [https://www.bitchute.com/video/793Cc3jwe8Ih, 26:23 / https://childrenshealthdefense.org/defender/dr-ryan-cole-shots-hooker/] He probably referred to Bisharat, but Cole didn't mention if the clots the surgeon was pulling out were a novel type of white fibrous clots or not. If Bisharat was supposed to be seeing calamari clots in living people in May 2022, then he might count as the earliest person who is said to have seen calamari clots in living people.

Matt Shelton

Greg Harrison claimed that Matt Shelton had seen calamari clots in a living person: [https://x.com/Greg21143362/status/1910659753061007514]

In the thread below, John O'Looney wrote that vaccines contain graphene razor blades that are activated by 5G. When someone asked him if we need any more scary stories, Matt Shelton replied "Well apparently we do Jennine. The white clots are real enough. I've seen and stretched them. Blood looks terrible now." [https://x.com/sussdoc/status/1847710982220509449]

Shelton also replied to another user in the same thread that "I've seen his and others' and my own clots. Stretched them myself." [https://x.com/sussdoc/status/1847715403134619667]

However when Shelton said he had stretched his own clots, it was not clear if he meant clots he had removed himself from the body of a living person, or from his own body, or something else. I haven't found any place where Shelton would've unambiguously claimed himself that he had seen the clots in the body of a living person.

In 2022 Matt Shelton did a video with Maria Zeee, where he claimed that vaccines contained nanotechnology and graphene oxide, and as evidence he presented images of supposed nanotechnology that were taken with an optical microscope: [https://rumble.com/vy0fic-dr.-shelton-and-sue-grey-evidence-of-nanotechnology-and-graphene-oxide-in-c.html]

The image below shows one of the images that Matt Shelton presented to Maria Zeee. He said he didn't know what the image showed but it was not a natural structure, and he said "The rounding on the corners, you know, this is precision, um, there's some sort of an algorithm to produce them": [41:25]

At the start of the video, Shelton said that he started researching graphene and nanobots after he had been contacted by a patient who had become magnetized after vaccination (in the same way that Quinta Columna claimed that vaccinated people were magnetic because of graphene oxide). And then he mentioned that his work was following in the footsteps of La Quinta Columna and people in Arne Burkhardt's pathology conference: [10:04]

Well, it was actually in response to having some patients contact us who found that they had become magnetized after their vaccination. So we had a look and met some people who, you know, indeed did seem to show some magnetism. And we - so we did a science report - we did a little research project, and came across La Quinta Columna and the work that they had done. And in fact, Dr. Campra had already done his very high-level science report where he had shown the presence of graphene-based, you know, microstructures, you know - the word nano was used, but now I refers to, you know, incredibly small scale, you know, you're almost down at the sort of molecular level - whereas he and his team were seeing things down a microscope. So as part of the report to the government on people's magnetism concerns, we included what we'd found around the graphene contamination and apparent chips and, you know, electronic circuitry also, it seemed.

And shortly after that, a German team of pathologists had a very powerful conference that they recorded and uploaded. And that's well worth everybody looking at. And that was in two parts. In the first half, they were describing the post-mortem findings and people who died after vaccination. And they were reporting things that they'd never seen in their whole careers. And in the second half, they were talking about particles that had been found on microscopy of the vaccine itself. So we first told government at the end of September last year that this stuff was emerging.

He was talking about Arne Burkhardt's so-called "pathology conference", which was held in the offices of Burkhardt's private practice in September 2021. Burkhardt's pathology conference was divided into two halves, where during the first half, Burkhardt presented microscope images of tissue of people who had supposedly died after vaccination, but during the second half, other participants presented microscope images of the contents of vaccines and the blood of vaccinated people. I believe Burkhardt never published any proper written report about his findings, but he presented his findings in videos where he showed scary microscope images, which were reminiscent of videos by La Quinta Columna. People in Burkhardt's conference said that vaccines contained minirobots, graphene oxide, and a parasite called Tryponasoma cruzi, and that the blood of a vaccinated person contained a synthetic fiber that may have been a Morgellons fiber. [turbo.html] Burkhardt's conference featured Füllmich's assistant Viviane Fischer, and the conference was portrayed as a press conference in the fashion of Füllmich's press conference larping operations, so at first I thought the conference was organized by Füllmich, but I didn't find Füllmich being involved with the conference. Burkhardt's conference is also notable because the term "turbo cancer" was first introduced in his conference. The term was specifically used by the lawyer Elmar Becker, who was a member of an organization called Lawyers for Enlightenment, which was co-founded by Füllmich. Becker conveyed an anecdote about turbo cancer from the German alternative medical practicioner Ute Krüger, who claims to have access to "energy field technology" which enables her to detect imbalances in the energy field which is the "non-material part through which the body and soul communicate".

Matt Shelton has also been interviewed by Philip McMillan. I have found 5 people who have personally claimed that they have seen calamari clots in the body of a living person (or possibly 4 since I'm not sure if Shelton should be included), but all except one of the people have been interviewed by McMillan. During the interview with Shelton, McMillan said: "Once you speak about embalmers' clots, you get put into a category of a conspiracy theorist. Now the question is, if you take that one step further, and you go into the category of vaccine nanobots, you are therefore an ultra conspiracy theorist. Now, I am saying this because I just recently did a video on this paper that was produced by two people - one in South Korea one in Japan - about changes - or things - in the vaccine." [https://www.youtube.com/watch?v=FFJwkSaIVHE&start=37m12s] Then McMillan and Shelton discussed the nanobot paper by Youngmi Lee and Daniel Broudy in IJVTPR, but both McMillan and Shelton presented the paper in a positive light, even though the paper was obviously fake.

Shelton told Philip McMillan: "I know Daniel quite well - Daniel Broudy. But I know that he's in a group, and is well connected with a lot of other scientists who have been doing similar work. So the paper that they have published, I think, you know, is a proxy for plenty of other people producing similar findings, some of whom have been brave enough to go public. But many others I think aren't." [41:12] Then McMillan said: "When I looked at the paper, one of the authors was an obstetrician and the other one was a professor of linguistics. But when I looked at the paper itself and the research that they did, I thought to myself they definitely had professional help. This is not the - you know - and so I realized, just as you said, this looks like a proxy paper. They were willing to put their names on it, but the research was actually done by very experienced independent scientists who probably couldn't publish that on their own." [42:52] Then Shelton said about Daniel Broudy: "I know Daniel, and he actually has a very important, um, professional background, um, that's, that's far more relevant than his linguistics. But he is as a, you know, a goldmine on the way that language is used, um to propagandize, um you know, and force ideas and arguments onto people. And I think that it was very important that somebody like him had a kind of an oversight into, you know, the structure of the paper." [44:44] By Broudy's relevant background, I don't know if Shelton meant Broudy's background in military intelligence, image analysis in the military, or propaganda studies.

When Shelton said that Broudy was in a group, he probably meant the International Interdisciplinary Research Team, which also included people like Matt Shelton, Youngmi Lee, Ana Mihalcea, David Nixon, Shimon Yanowitz, Sasha Latypova, and Gerry Brady. IIRT's Brighteon channel consists of interviews of the group's members by Daniel Broudy. [https://www.brighteon.com/channels/iirteam/home]

In 2022 IJVTPR published a paper about nanobots by Daniel Broudy and Valerie Kyrie, who cited Shelton's video about nanobots in vaccines. [https://ijvtpr.com/index.php/IJVTPR/article/view/49] Valerie Kyrie's bio says that she works "in the areas of political psychology, the psychology of atrocity, and psychological operations / perception management" and that "her doctorate in psychology focused on the topic of reality-perception and its manipulation".

Shelton is a co-founder of NZDSOS (New Zealand Doctors Speaking Out with Science), which posted a tweet that promoted An Unholy Triad. [https://x.com/nzdsos/status/1894285548929650831] Shelton was credited as one of the three executive producers of An Unholy Triad, along with Brenton Faithfull and Wayne Crouch's cohost Lisa Johnston. The "scientific research and advisory team" of the videos included the IIRT members Matt Shelton and Gerry Brady, along with Greg Harrison, Bruce Rapley, Daniel Santiago, and Andrew Zywiec.

Shelton also promoted An Unholy Triad on Twitter: [https://x.com/sussdoc/status/1894296773033664957]

Here Shelton criticized a paper for not mentioning Greg's fake ORFs: [https://x.com/sussdoc/status/1907582885647057222]

Here Shelton came to the defense of the fake journal IJVTPR (whose editorial board includes his fellow IIRT members Daniel Broudy and Shimon Yanowitz): [https://x.com/sussdoc/status/1867998760892301331]

Matt Shelton also says that vaccinated people are magnetic. NZDSOS published an article about the calamari clots, which said this about the clots: "But perhaps, like the temporary magnetism in some vaccinated, and the self assembling microtech - supported by a considerable scientific literature - these topics seem too outlandish for many people to contemplate." [https://nzdsos.com/2024/02/20/rubbery-clots-campbell/] The article also mentioned that the clots were "gel/plastic" according to David Nixon: "Another term gaining momentum is gel/plastic, as coined by NZDSOS member David Nixon who is doing very important work at his microscopy substack."

In 2022 when Maria Zeee interviewed the NZDSOS member David Nixon, she broke the news that Nixon had found robot arms in COVID vaccines. Zeee said: "I want to ask you, Dr. Nixon, because it looks like little robot arms, even." [https://rumble.com/v1prv94-world-first-robotic-arms-assembling.html?start=532] Then Nixon pointed to the area of the video below where I added the red circle, and he said: "This is - this - you look at the way the levers are working in this - but, you know that - you've got triangles, you've got levers, you've got pinchers. [...] It even falls up on itself, goes up to get the leverage. [...] It creates some sort of a propulsion system, I mean, you look at the rotation on that."


In November 2022, Ana Mihalcea hosted a video that featured Matt Shelton and Mat Taylor. Her blog post about the video said that "All of us are part of an International Research Collaboration to assess the C19 vials and evidence of Nanotechnology." [https://anamihalceamdphd.substack.com/p/graphene-in-rainwater-surgical-masks] At the end of the video, Mihalcea also said: "I'm so excited and so honored to be part of a team with both of you guys - and our larger team - it's just phenomenal visionary rebel geniuses around the world that are just brining it. I love it." [https://rumble.com/v1qyb2i-graphene-in-rainwater-surgical-masks-pcr-swabs-and-c19-vials.html?start=4264]

The team probably refers to IIRT (International Interdisciplinary Research Team), which released a series of 8 videos that featured Daniel Broudy, David Hughes, Ana Mihalcea, David Nixon, Matt Shelton, Robyn Cosford, Gerry Brady, and Shimon Yanowitz. [https://www.brighteon.com/channels/iirteam/videos/all] Mihalcea wrote that the videos were done by Daniel Broudy: "Professor Broudy did a Documentary Series where he interviewed members of the international interdisciplinary research team. I was a part of this group in 2022 and 2023 with Dr. David Nixon, Dr Young Mi Lee, Dr. Broudy, Dr. David Hughes and others." [https://anamihalceamdphd.substack.com/p/breaking-news-millions-of-self-assembly] David Nixon wrote that Sasha Latypova was also part of the group. [https://drdavidnixon.com/1/en/topic/week-9]

At time 3:01 in the video with Mihalcea and Shelton, Mat Taylor said that these were Morgellons fibers he found in rainwater: [https://rumble.com/v1qyb2i-graphene-in-rainwater-surgical-masks-pcr-swabs-and-c19-vials.html?start=181]

At time 59:39, Shelton presented the image below, which he said showed the contents of a vaccine vial, and he said: "Just at the end, another one of these, you know, little round donuts - that seems to be a progenitor, um, you know, eggs from which a lot of the activity of the machines - or gadgets or whatever they are - seems to be built from just pops up."

Next he showed the image below and said: "Um, so this is in vaccine and, and again, another very commonly seen, um, tube." Then Mihalcea said: "And we see this all the time. I see this in unvaccinated blood, um, I, uh, as well as, you know, people around the world have seen it in vaccinated blood. But I think, you know, this shedding phenomenon or whatever effects there is - or whether or not it comes from chemtrail spraying and environmental causes - but this is a normal. I mean, these are huge structures. They're, you know, hundreds of times larger than red blood cells. And they shouldn't be in people's blood. And they're everywhere."

Next Shelton said "so this is a, you know, tube turned up in the, in a sample of the flu vaccine", and he showed this image:

And next he also showed this tube:


In March 2022 when Matt Shelton spoke to a crowd outside the New Zealand parliament, he said "I want to particularly recommend orwell.city - Orwell as in George Orwell's 1984 - orwell.city, and a site called lifeoftheblood.com". [https://rumble.com/vvaeng-dr.-matt-shelton-undeclared-components-found-in-covid-19-vaccines-18.02.22.html?start=121] But orwell.city is a website that publishes La Quinta Columna's content translated to English. [https://www.orwell.city/]

He also said: "We wrote on the 27th of September last year - to MedSafe administers - to alert that emerging finding from overseas of nanotechnology gadgets largely made of graphene, and known poisons in humans, in all the major brands tested. That work from Spain has now been confirmed elsewhere, including Germany, Austria, Argentina, and just last week, in a high-level science report from the UK, also with legally valid chain of custody proof. And you guys know what that means. That no fraud can have occurred, and the results are real." [3:27] By Austrians, he probably referred to the Austrian research group who presented their microscope images at Burkhardt's conference. [https://pathologie-konferenz.de/en/]


Added later: In June 2025, a video vent viral where Suzanne Humphries said that she saw microchip-like structures in COVID vaccines under a microscope. She said the photos in the tweet below were her photos, and that lifeoftheblood.com was her website: [https://x.com/DrSuzanneH7/status/1935106404257501500]

In 2022, the bottom right image in her tweet was presented by Matt Shelton as an image by "scientists from New Zealand": [https://rumble.com/vvaeng-dr.-matt-shelton-undeclared-components-found-in-covid-19-vaccines-18.02.22.html]

The article at lifeoftheblood.com was written in the first person, but Matt Shelton gave an impression that the images on the website were taken by a team of scientists. In a video in January 2022, he said: "So we were contacted during the week by a group of scientists who have been doing some scientific analysis - microscopy work - on the Pfizer vaccine." [https://rumble.com/vtlt4q-undeclared-nanotech-in-the-pfizer-shots-new-zealand-scientists-have-also-fo.html] In 2022 he also told Maria Zeee: "But I, you know, I went and I met these scientists. I saw their work. I saw their microscope. You know, and I trusted absolutely that they found what they'd say." [https://rumble.com/vy0fic-dr.-shelton-and-sue-grey-evidence-of-nanotechnology-and-graphene-oxide-in-c.html?start=2012] During an interview with Mihalcea he said: "These aren't my images. We actually have this microscope now, but they're taken by a team who've actually got a very good website where they put a lot of their stuff called lifeoftheblood.com." [https://rumble.com/v1qyb2i-graphene-in-rainwater-surgical-masks-pcr-swabs-and-c19-vials.html?start=3145]

The images Humphries presented were published in an article at masksaredangerous.com dated January 29th 2022 UTC, which was the same day when the videos were uploaded on a BitChute channel called LifeInTheBlood. [https://web.archive.org/web/20220129095012/https://masksaredangerous.com/nanotech-in-the-shots/, https://www.bitchute.com/channel/xH8GzgT36J1V] The version of the article posted at lifeoftheblood.com was dated February 3rd 2022 UTC. [https://web.archive.org/web/20220204002856/lifeoftheblood.com/nanotech-in-the-shots/] There was no author listed on either website. The lifeoftheblood.com website said that the website was run by an "international group of concerned citizens, scientists and medical practitioners". [http://web.archive.org/web/20230308072151/http://lifeoftheblood.com/] But in 2025 Humphries gave the impression it was her personal website, and she didn't mention there was any team behind the website.

After Humphries was criticized on Twitter for the video where she said that the vaccines contained structures that looked like circuit boards, she replied: "Please show me where I said that they were circuit boards. I said they looked like circuit boards and I said specifically that I am not saying that they are circuit boards but they look like circuit boards." [https://x.com/DrSuzanneH7/status/1936234246982844713] But the article at lifeoftheblood.com said that this was "obviously an image of some sort of nano-tech chips":

The article at lifeoftheblood.com uses British spelling for some words like "organisation" and "self-organised" but US spelling for other words like "organization" and "specialized". However the article uses Celsius degrees which is the standard in New Zealand.

The author of the article wrote: "I am a physician in good standing, having a background in mathematics and physics from university, then specialized beyond internal medicine after residency." Humphries has a bachelor's degree in physics, and in her autobiography she wrote that she studied mathematics as part of the physics curriculum. The author also said: "People who were injured by the Pfizer jab started showing up in my practice." I don't know if Humphries has a medical practice in New Zealand, even though during an interview with Catherine Austin Fitts, she said she lived in New Zealand, and she said "I was as a clinician dealing with people who were injured from the vaccine." [https://solari.com/mrna-will-we-figure-out-what-the-mysterious-ingredients-are-with-dr-suzanne-humphries/, 11:11] During the interview, she also claimed that some of her images showed the blood of her patients.

The masksaredangerous.com blog had only two posts published before the post about nanotechnology, one of which announced the launching of the blog, and the other was a post about face masks. The author of the post about face masks was shown as "Dr. Nate Semmelweis". [http://web.archive.org/web/20200927214054/https://masksaredangerous.com/but-surgeons-wear-masks-for-hours/] When I googled for "Dr. Nate Semmelweis" in double quotes, there were only a few results, which all referred to the post about the face masks. The name is probably a pseudonym dervied from Ignaz Semmelweis, who was a doctor in the 1800s who was persecuted because he advocated for surgeons to wash their hands. There's also a COVID blogger who uses the pseudonym Iggy Semz, which is derived from the name Ignaz Semmelweis, but I don't know if Iggy Semz is the same person as Dr. Nate Semmelweis.

The post about nanotechnology and the post about face masks were both copied to a blog called "Truth B Told". [https://blog.truthbtold.link] It was the same type of minimal WordPress blog with only a few posts as masksaredangerous.com. The Truth B Told blog had only a couple of other posts, but two of them were about Qanon. The author of all posts was listed as "Shaman Starseed", and the name of the admin user was "starseed".


In July 2025 Catherine Austin Fitts published an interview with Humphries. [https://solari.com/mrna-will-we-figure-out-what-the-mysterious-ingredients-are-with-dr-suzanne-humphries/] The video also featured Ulrike Granögger, who is the host of Solari's Future Science series, where she has presented videos about topics like 5G causing COVID, and the impact of nanobots on the "wave genome". [https://science.solari.com]

Humphries said that she originally published her microscope images anonymously in 2022, because she didn't want to risk her chance of obtaining citizenship in New Zealand. But she said she got the impetus to come out of the closet as the author of the images because of something that Catherine Austin Fitts said: "I just never went public, and the whole thing went to sleep in my mind. And what happened was that - I think it was a couple of months ago, I was - I heard Catherine talking on a podcast somewhere and, you were talking a language that I kind of understood regarding the future plans for possibly connecting humans to the internet. And I flashed back on some of these images again, and I just thought, 'Should I just let it die, or should I tell Catherine?' And so I think I sent you some of the images, and you said, 'Oh, we've got to get you on.' And I was like, 'Ok.' So that's how this all started." [14:21]

At time 27:36, Humphries said that the IJVTPR paper by Daniel Broudy and Youngmi Lee was a "beautifully, eloquently written article, very long, very detailed analysis", but she didn't have anything critical to say about the paper. Then Fitts said: "So, I just wanted to mention, Daniel Broudy is the one of the three who joined Patrick Wood on the Omniwar symposiums. So, Lissa Johnson - he's the colleague with David Hughes and Lissa Johnson who've been doing this." Then Ulrike Granögger said: "I'd like to mention that I know both of the - I'm part of the study group that is meeting - or has been meeting - every month, or every week in fact. And we were briefed by Youngmi many many times by what she was doing - like she was observing the evolution so to speak, or she calls it incubation of vaccines, and all kinds of liquids, bodily liquids with the vaccines, over long long periods of time. And this is all done impeccably. So I thought this article was groundbreaking, and I was amazed how strong the opposition to it was. Because they don't make big claims, they say 'It could be.'"

Then Humphries pointed out that the authors found that sperm cells were destroyed when they were exposed to a vaccine, and she said "I have still some regard for this paper, and I'm not going to toss it out". She pointed out that the paper said "Furthermore, the bundles and ribbons could be more durable and long-lasting silica, or they may be synthetic graphene-coated polymer nanotubes, or similar nanowires serving as conductors or semiconductors", and she said: "They're just talking about what their assumption is. It's called a hypothesis in science. That's how things begin. And, you know, they were calling for further evaluation. Okay, good for them." But she didn't say anything about how nanotubes and nanowires would not be visible with an optical microscope.

At time 1:15:32, Humphries showed the image below, and she said: "So that happened more than anything, and it was it was like pink. So it would be, you know somehow a whole lot of fiber - fibrin. You don't even see red blood cells anymore, so it was just a complete disintegration of what was normally there, and it was replaced by this kind of weblike pink network of whatever." Then Ulrike Granögger pointed out that fibrin was also being found in the embalmer clots. The image shown by Humphries wasn't posted at lifeoftheblood.com, and I didn't find it posted elsewhere on reverse image search engines either:

At time 1:21:34, Fitts said: "We were part of a group of people trying to understand why there was spraying in the United States and all over the world, and what was in the spray, because it was causing Morgellons disease. You have these really unusual unnatural fibers that were getting into people's body. And we just did an interview with Clifford Carnicom, who's been our sort of go-to source, and what he said is that the materials that he found in the spray are essentially the same materials that are getting into the injections." I don't know if Carnicom meant spider silk, Morgellons fibers, Morgellons bacteria, hydrogel, or something else.

At time 1:31:00, Fitts said: "We - Ulli and I - had a lot of experience with Arne Burkhardt". I have an unpopular theory that Arne Burkhardt was a Quinta Columna type plant in alt media, but if he was connected to Fitts and Ulrike Granögger, then there's even more reason to be suspicious of him. Burkhardt's collaborator Sucharit Bhakdi was the figurehead of Doctors for COVID Ethics, which hosted a series of symposiums in collaboration with Solari. One of the symposiums featured a presentation by the nanobot guys Daniel Broudy and David Hughes, who later became the stars of Solari's "Omniwar" symposiums.


Hilary Butler is a long-time anti-vaccine activist from New Zealand, who posted this reply to my comment at Substack: "Dr Suzanne Humphries never spoke of nano bots or graphene. Matt Shelton visited Suzanne and persuaded her to hand over the files of her work under the guise of taking them to the police as evidence, only to go public and say anything he wanted to say. He will corroborate that he got the images from Dr Suzanne. Dr Suzanne wrote about Semmelweis in Dissolving Illusions and I happen to know that she used the name Nate Semmelwies early on (on masksaredangerous site which was created in a rush by an amateur friend of hers before covid vaccines were released when the mask issue was upsetting her) when she was anonymously talking about the images, only to later put them up on a site called lifeoftheblood, which she closed as she didn't want to keep paying for her server fees. She moved them to bitchute where they remain. Funny enough Jayne Ruby launched a surprise attack against Suzanne after the Joe Rogan podcast, where she accused Suzanne of 'coming out of nowhere'." [https://openvaet.substack.com/p/from-opioids-and-fraud-to-maga-and/comment/135014599]

Butler said that Humpries used the name Nate Semmelweis "when she was anonymously talking about the images", but I didn't actually see the name mentioned in relation to the microscope images, but I only saw Nate Semmelweis being credited as the author of the earlier post about masks at masksaredangerous‍.com.

Butler's explanation seems somewhat plausible, but it's still weird how the blog post at lifeoftheblood.com was written in a mixture of British and American English. Shelton also said that the microscope photos were taken by a team, but Humphries made it seem like she took the photos by herself.

Butler gave the impression that masksaredangerous.com was essentially a personal website of Humphries, because if you don't count the short introductory article, the website had only two articles, but Butler indicated that both of them were written by Humphries. However the "Who We Are" page on the website said that one of their editors was a male medical doctor: "One of our editors is a licensed medical doctor and he never thought twice about wearing a mask in surgery or in a patient room with a known infection like TB, or even swine flu." [https://archive.md/uR1J0] The same page also said: "Our group of educated parents, authors, and doctors do not believe that masks should be worn by anyone who is well." I didn't see any features of British English employed on the page, but the words "favor", "license", and "airplane" were all written in American English.

Suzanne Humphries consistently misspells Jane Ruby's name as "Jayne Ruby", and she writes "nano bots" with a space. [https://x.com/search?q=from%3ADrSuzanneH7+%28jayne+OR+%22nano+bots%22%29&f=live] Hilary Butler's comment also said "Jayne Ruby" and "nano bots", so I don't know if Humphries wrote the comment but asked Butler to post it, or if Butler copied parts of her comment from some messages she got from Humphries, or if Butler had learned the misspelled from of Jane Ruby's name from posts by Humphries.

Butler's comment employed single quotes instead of double quotes, and the word "Dr" was written without a period, which are both features of British English. But even if the comment was written by Humphries, it's possible that she would've deliberately written the comment in British English even though she's an American.


When I searched BitChute for the name of David Hughes in double quotes, the oldest result was a clip of a video by Hughes with subtitles added by La Quinta Columna. [https://www.bitchute.com/search?query=%22david+hughes%22&sort=old] The second-oldest result was an interview he did with Mihalcea, which featured the slide below that contained images from lifeoftheblood.com, Quinta Columna, and people at Burkhardt's conference. Hughes said this about the image from lifeoftheblood.com: "Now, for all the world, that does look like some kind of technology to me - the bottom left. It looks almost like we're in outer space, and we're dealing with antennae and motherboards, and this kind of thing." [https://www.bitchute.com/video/NKxjTRgM0tGn, 22:27]

An Unholy Triad and mystery ORFs

An Unholy Triad and mystery ORFs discovered by Greg Harrison

In 2025 Wayne Crouch from Australian National Review published a series of videos titled "An Unholy Triad: The Birth of a Plague". The videos were narrated by an AI voice, and even the script of the videos sounded like it was generated by AI, so I don't know if the videos were made with some AI video generation software.

The credits of the videos listed Wayne Crouch, Lisa Johnston, Brenton Faithfull, Matt Shelton, Greg Harrison, Bruce Rapley, Daniel Santiago, Andrew Zywiec, Gerry Brady, Todd Callender, Richard Hirschman, and John O'Looney: [https://rumble.com/v6paaoo-an-unholy-triad-the-birth-of-a-plague-episode-01.html?start=454]

Wayne Crouch is the "head reporter" at Australian National Review, which looks like an Aussie version of the Stew Peters Network. The front page of ANR's website even featured two interviews of Stew Peters: [https://anr.news]

Wayne Crouch has only 15 subscribers on his BitChute channel, but somehow he still managed to book interviews with people like Robert Malone, David Icke, and Errol Musk: [https://www.bitchute.com/channel/Bbk5AP5d]

The main theme of the Unholy Triad videos was that Crouch's team had supposedly found new mysterious ORFs in SARS-CoV-2. In the first episode of the series, the AI narrator said: "Direct evidence, lab records, internal PLA documents, and intercepted communications confirms China engineered three ORFs critical to SARS-CoV-2. ORF11: Documents from the early 2000s detail a gene enhancing viral entry into human cells, tested in bat coronaviruses at WIV to boost infectivity. ORF19: Research logs from 1999 to 2005 describe a sequence amplifying viral replication designed to accelerate spread uncovered in PLA virology studies. ORF29: Military reports from 2003 to 2008 outline a gene modulating host inflammatory responses intended to exacerbate disease severity trace to WIV experiments." [https://rumble.com/v6paaoo-an-unholy-triad-the-birth-of-a-plague-episode-01.html?start=288] But none of the mysterious "research logs" or "military reports" were actually shown in the video series.

In the 5th episode of An Unholy Triad, the AI narrator said that ORF19 and ORF29 are responsible for the formation of clots: "The ORFs are the masterminds, ranked by their deadly impact. The ORF19, fueled by phosphorus, locks fibrin and actin into indestructible amyloid-like clots, the backbone of this nightmare. Second, ORF29 with tin cements them rigid ensuring they resist all breakdown. Third, ORF8 twists immune evasion by blinding T-cells, letting clots thrive unchecked. Fourth, ORF3a ignites inflammation and tissue chaos, amplifying clot formation. Fifth, ORF11 blocks cellular cleanup prolonging the damage. And then in sixth place is ORF6: it cripples interference, weakening early defenses." [https://rumble.com/v6qrijq-an-unholy-triad-the-birth-of-a-plague-episode-05.html?start=205] In another episode of An Unholy Triad, the AI narrator said: "We've ranked the ORF: ORF6 is quiet sabotage, ORF11 is cleanup block, ORF3a is chaos, ORF8 stealth, ORF29 cement, ORF19 slaughter. A kill chain forged in the abyss." [https://rumble.com/v6r40im-an-unholy-triad-the-birth-of-a-plague-season-02-episode-01.html?start=130]

Wayne Crouch wrote that documents describing the mystery ORFs were deciphered by "our chemist", which refers to Greg Harrison who is a chemist, and who is a member of the Solution of Scientists group that also includes Wayne Crouch: [https://puremediaaustralia.org/f/global-conspiracy-exposed-unveiling-the-ultimate-bioweapon]

The Revelation

Our brilliant Chemist, part of a scientific research team we call "A Solution Of Scientist's".

Has unearthed evidence suggesting that the Soviet Union (now Russia), the United States, and China (PLA) have collaborated in a dark trinity to engineer what can only be described as the ultimate bioweapon.

This weapon, disguised within the fabric of a global health crisis, leverages the genetic capabilities of viruses, particularly through the modification of viral Open Reading Frames (ORFs), to achieve its deadly purpose.

The Evidence:

Historical Bioweapon Research: Our investigation reveals a lineage from the Soviet-era chemical clotting agents and fibrinolysis inhibitors, through U.S. advancements in immune modulation, to the Chinese mastery in synthetic biology and gain-of-function research.

Each nation's contribution has built upon the previous, culminating in a sophisticated bioweapon.

Modified ORFs: Our Chemist's research has deciphered documents written in what we now understand to be bioweapon nomenclature, a language reserved for those with clearance in bioweapon programs.

These documents detail modifications to ORFs like ORF10, ORF11, and ORF19, which are not just coincidental in their effects but engineered for specific, lethal outcomes including persistent clotting, immune evasion, and systemic amyloidosis.

As an example of the secret bioweaponeer code that was deciphered by Greg Harrison, here "Hetnody Ane Uadeeanchounsylnfrtn" is code for "Cytokine-Anchored Systemic Inflammation": [https://x.com/Greg21143362/status/1888539927929037124]

Harrison was seriously trying to pass off the AI-generated images above as images that employed a secret Chinese bioweaponeer code. He posted the images in a Twitter thread where he showed screenshots of a file called Chinese_Dialect_ORF_Maps_ALL-comparisons_9_1_25.doc: [https://x.com/Greg21143362/status/1888539927929037124]

Greg Harrison also tried to pass the image below off as a real plasmid map, where the caption says: "The plasmid map shown here, with detailed annotations of ORF-11, ORF-19, and other spike protein modifications, suggests a high-level bioengineering analysis, likely produced by a research institution specializing in synthetic biology, virology, or classified military bioweapon research." [https://x.com/Greg21143362/status/1891241646051705287/photo/1]

Greg Harrison also posted the screenshot below, which said that there were "ORF-19 components dispersed throughout the SARS-CoV-2 genome (as depicted in the provided map)", and it included an image of the same fake plasmid map where there were 4 different labels for ORF19 (even though of course SARS-CoV-2 is not even a plasmid and it doesn't have a circular genome): [https://x.com/Greg21143362/status/1888535914789454191/photo/1]


The hoax about ORF11 and ORF19 seems to have been inspired by a thread from 2023 by the Japanese Twitter user Patent_SUN. He showed that when the Twitter user mbi92710920 ran ORFfinder on McKernan's Pfizer plasmid sequence, the ORF for the spike protein was labeled ORF11, and the long ORF on the reverse strand that spans almost the entire length of the spike protein was labeled ORF19: [https://x.com/Patent_SUN/status/1699619448909713661]

Patent_SUN also posted this plasmid map for the ORFs (where there's just a single ORF19 on the reverse strand, and not multiple different "ORF-19 components" like in Greg's AI hallucination):

You can try to run ORFfinder yourself here: https://www.ncbi.nlm.nih.gov/orffinder/. If you enter "OR134577" to the big text field and click "Submit", the ORF of the spike protein is numbered ORF11, and the long reverse ORF is numbered ORF19:

The longest ORF on the reverse strand of McKernan's Pfizer plasmid sequence is 1252 amino acids long: [https://www.ncbi.nlm.nih.gov/nuccore/OR134577]

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=OR134577'>pfizerplasmid.fa
$ r=$(seqkit seq -rp pfizerplasmid.fa|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit seq -gm4|seqkit stat
file  format  type     num_seqs  sum_len  min_len  avg_len  max_len
-     FASTA   Protein        54    2,858        4     52.9    1,252

The long reverse ORF exists only in the Pfizer vaccine but not in the virus, because the ORF is a byproduct of the codon optimization which coincidentally happened to remove the stop codons from the reverse strand. In the reference genome of SARS-CoV-2, the longest ORF on the reverse strand of the spike protein is only 82 amino acids long:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_na&id=MN908947'|seqkit grep -nrp gene=S>sars2spike.na
$ r=$(seqkit seq -rp sars2spike.na|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit seq -gm4|seqkit stat
file  format  type     num_seqs  sum_len  min_len  avg_len  max_len
-     FASTA   Protein        35      642        4     18.3       82

Patent_SUN's thread said that there are 23 prion motifs in ORF19, which meant that the reverse ORF has 23 matches to the motif GXXXG:

$ r=$(seqkit seq -rp pfizerplasmid.fa|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit sort -lr|seqkit head -n1|seqkit locate -rPpG...G|sed 1d|wc -l
23

So therefore Greg's crew claims that ORF19 is the "most dangerous" ORF because it has the highest number of matches to GXXXG: [https://x.com/CoyoteSanctuary/status/1904011361538957764]

But then is ORF1ab even more dangerous than ORF19? ORF1ab has 24 matches to the GXXXG motif, which is even higher than 23 matches in the long Pfizer reverse ORF:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=NC_045512'>sars2.aa
$ seqkit locate -PrpG...G sars2.aa|awk 'NR==FNR{a[$1]++;next}{print $1 in a?a[$1]:0,$0}' - <(seqkit seq -n sars2.aa)|sed 's/ .*protein=\([^] ]*\).*/ \1/'
24 ORF1ab
15 ORF1a
7 surface
0 ORF3a
0 envelope
1 membrane
0 ORF6
1 ORF7a
0 ORF7b
0 ORF8
5 nucleocapsid
0 ORF10

Greg Harrison's AI-generated table of fake ORFs

Greg Harrison posted the table below, where he now has mystery ORFs going up to ORF100: [https://x.com/Greg21143362/status/1906271151120097528/photo/2]

The data in the table looks fake, because the Q/N content and R/K content values are all divisible by 5. For example ORF85 is shown to have 15% Q/N content, but the length of ORF85 is 28 aa, and 4/28 is about 0.143 and 5/28 is about 0.179, so neither is 15% when rounded to the nearest integer. There is no integer you can divide by 28 that produces a percentage of 15% when rounded to the nearest integer.

Greg's table shows that ORF10 is 38 aa long, which matches the real length of ORF10 in Wuhan-Hu-1 if you don't count the stop codon. But Greg's fake ORF10 has 10% Q/N content and 20% R/K content, even though in the real ORF10 in Wuhan-Hu-1 there's 1 Q residue and 5 N residues, so there's about 16% Q/N content, and there's 2 R residue and 0 K residues, so there's about 5% R/K content:

$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=NC_045512'|seqkit grep -nrp ORF10|seqkit seq -s
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT

Greg's table also shows that ORF29 is 60 aa long and has 50% Q/N content. There's a total of 59,448 possible 60 aa segments of Wuhan-Hu-1 on all 3 frames of both strands. But the highest number of Q and N residues in any of the segments is 16, and 16 divided by 60 is only about 27%:

$ (seqkit replace -p'.*' -rforward sars2.fa;seqkit seq -rp sars2.fa|seqkit replace -p'.*' -rreverse)|seqkit sliding -W180 -s1|seqkit translate|seqkit fx2tab|awk '{x=$2;print gsub(/[QN]/,"",x),$1,$2}'|sort -rn|head
16 reverse_sliding:9317-9496 Q*SL*QP*KLQINLGILLFQQNHQVINQ*QNTHT*MNLFAHLL*NSF*LYCP*E*NLLIQ
16 reverse_sliding:8894-9073 QLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQLM
16 reverse_sliding:8891-9070 VQLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQL
16 reverse_sliding:8888-9067 YVQLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQ
16 reverse_sliding:15020-15199 NQSTYQQLQLQIVVV*YHTLLVDYNDSSHNR**QHYHPEQRRSVLIQQNFLP*RNP*TQQ
16 reverse_sliding:15017-15196 NNQSTYQQLQLQIVVV*YHTLLVDYNDSSHNR**QHYHPEQRRSVLIQQNFLP*RNP*TQ
16 forward_sliding:24299-24478 QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA
16 forward_sliding:24296-24475 TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFG
16 forward_sliding:24293-24472 VTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNF
16 forward_sliding:24290-24469 GVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSN

Out of the 8 ORFs in Greg's table, ORF10 has the same length as the real ORF10 of Wuhan-Hu-1, but 5 out of the 7 imaginary ORFs have a length that is divisible by 5. If you pick 7 random integers in the range of 22 to 75 so that repetitions are allowed, the likelihood that 5 or more of the integers are divisible by 5 is about 0.5%:

v=22:75;sum(dbinom(5:7,7,sum(v%%5==0)/length(v)))
# 0.005083313

I gave this prompt to Perplexity: "generate table of imaginary ORFs 10, 11, 19, 29, 85, 45, 60, and 100 of SARS-CoV-2 with length ranging from 22 to 75 aa, with columns 'Length (aa)', 'Q/N Content (%)', 'R/K Content (%)', 'Disorder Score (IUPred avg)', 'Aggregation Score (TANGO)', and 'Prion-like domain score (PLAAC)'". 7 out of 8 ORFs had a length that was divisible by 5. And all of the Q/N content and R/K content percentages were divisible by either 5 or 2:

When I called Greg out for his table of fake ORFs on Twitter, he posted a diagram of ORFs in some random bacteriophage, and he wrote: "The presence of small, highly functional hidden ORFs (ORF11, ORF19, ORF29) in SARS-CoV-2 is biologically plausible, evolutionarily validated by known phage models". [https://x.com/Greg21143362/status/1916650890393752010] But I replied to him: "An ORF19 in some random phage doesn't have anything to do with cryptic ORFs in SARS-CoV-2. And the ORF19 in the Pfizer vaccine was produced by codon optimization so it doesn't even exist in SARS-CoV-2. I thought you already dropped your ORF hoax." But he replied: "Thank you for your comment. To clarify: our research does not claim direct sequence homology between phage ORF19 and SARS-CoV-2. Rather, we use phage modular ORF clusters as an evolutionary analogy for how small hidden ORFs can persist and function biologically. The presence or absence of ORF19 in vaccine codon-optimized constructs is separate from its potential existence in wild-type SARS-CoV-2 genomes. Our current research is focused on bioinformatics and mass spectrometry validation of cryptic ORFs in the wild-type virus, using evolutionary, structural, and functional evidence chains." And I replied: "The ORF19 in your phage is not a 'hidden ORF', but it's a regular ORF that codes for a functional gene, and that is not a nested ORF hidden inside some other ORF: https://ncbi.nlm.nih.gov/nuccore/CU468217." I also wrote: "The numbering of the ORFs depends on what utility you use to annotate the ORFs, what minimum length for ORFs you use, and whether you include alternative start codons. The region of the vaccine plasmid that happened to be annotated ORF19 by ORFfinder is not an ORF in SARS-CoV-2." But Greg replied to me: "To clarify: the ORFs analyzed are frame-specific translations from synthetic mRNA constructs related to vaccine plasmids, not from the SARS-CoV-2 Wuhan-Hu-1 viral genome itself. Direct comparisons to viral frames are therefore not applicable. In addition, Q/N enrichment is only one of several properties assessed for prionogenic potential, alongside motif patterning and disorder prediction." But I pointed out to Greg that in his image of the fake ORFs, the text below his table said that the ORFs were "SARS-CoV-2 ORF peptides", and his ORF10 was 38 aa long like the real ORF10 of Wuhan-Hu-1. And I pointed out how even in McKernan's Pfizer plasmid sequence, the highest percentage of Q and N residues out of any 60 aa segment is only about 27%.

Deadly amyloid marine black balls

Mysterious black balls have been found shoring up on beaches in Australia. [https://www.theguardian.com/australia-news/2024/nov/09/nsw-regulator-chose-to-reveal-content-of-sydneys-mystery-beach-balls-on-day-of-us-election] Greg Harrison came up with a novel theory that the balls are formed because misfolded spike proteins end up in seawater, because he said that "ORF-driven spike misfolding" leads to the production of amyloid protein, which ends up in wastewater through shedding, and then after the wastewater runs off into the sea, the amyloid proteins aggregate into large black balls: [https://x.com/Greg21143362/status/1906598416341192741/photo/2]

Greg's theory was illustrated by this graphic, which shows how ORF11 and ORF19 lead to "amyloid-prionduction":

Wayne Crouch posted this tweet about how the black marine amyloid balls will kill everyone: [https://x.com/WayneC50256258/status/1906627345378844868]

Philip McMillan and mystery ORFs

In February 2025, Philip McMillan posted a Substack post where he promoted the first episode of An Unholy Triad. He said that the authors of the video had access to 6,000 pages of secret documents, and that in the event that any of the authors were silenced, the documents were going to be released as a dead man's switch. McMillan claimed to have personally seen some of the secret documents which described ORF11 and ORF19: [https://philipmcmillan.substack.com/p/covid-secrets-theyre-hiding-from]

I was woken up at 4 a.m. this morning with information so shocking that it has left me reeling. Over the past few years, I have had the privilege of speaking with some of the world's leading scientists, those who refuse to stop investigating the depths of COVID-19's origins and impact. But today's revelation is different. It is worse than even I had imagined.

For those who have followed my work, you know that I have always been driven by one question: What if we were never told the whole story? Now, thanks to a group of relentless scientists, we have 6,000 pages of documents that lay bare the full pandemic timeline, from inception to global rollout. And what they reveal is more than just negligence or incompetence; it suggests a deliberate obfuscation of critical facts.

[...]

Within these documents, there is one section that immediately caught my attention - the reference to modified ORFs (Open Reading Frames) 10, 11, and 19 in the SARS-CoV-2 genome. This seemingly minor genetic detail might hold the key to understanding the virus's impact on human biology, particularly its ability to drive unprecedented clotting mechanisms.

[...]

What makes this discovery even more alarming is the response from authorities. The scientists behind this breakthrough are already facing pressure from powerful institutions. Some have been warned not to publish their findings. Others have been contacted by government officials who want access to the data before it goes public.

Even as I share this with you, precautions are being taken. The lead researchers have secured multiple copies of the documents, and in the event that any of them are silenced, the information will immediately be released worldwide. There is no stopping this truth now.

The Substack post featured a video where McMillan said: "I was woken up at four o'clock this morning because of some really critical breaking news. I'm privileged to have access to scientists from across the world who are looking into every angle of COVID-19. And what they're finding out is truly horrific. It's worse than even I had thought, and I have been in this space for a long period of time. So I'm giving you my first insights because this is just the beginning. What they've uncovered is like 6,000 pages of documents that explain the full pandemic from start to finish. And as a warning - because when I was told this information, I said, 'This kind of information is the kind of thing that people get disappeared about.' And the response was they have anticipated that, and that if something happens to any of these scientists, this information will be circulated immediately across the world." At the end of the video, he said: "When you realize just how deep and how far this goes, you'll realize what we're up against. This is a time for transparency, and it truthfully was purely a - what appears to be a random act of an individual not stopping searching until they found the information that they needed, and then still not stopping until they found a way to decode that information. What they downloaded, the most important bits that they found could not be read because it was coded. They had to then develop a software to undo the code so that it could be interpreted. This was not supposed to come out. It's just the fact that some people will not stop. And we appreciate those scientists and we need to protect them and make sure that they continue to protect us by bringing the truth."


In March 2025, Philip McMillan livestreamed a video about the fake ORFs, where he was reading from a document titled Daniel_Santiago_ORF_relationships_Quantum_Codon_Energetics_12_3_25. [https://www.youtube.com/watch?v=BVg_aoK2EaM, https://x.com/i/broadcasts/1lPJqMDwNjdJb] I didn't find the document published anywhere, but McMillan showed these pages of the document during the stream:

So apparently there's now mystery ORFs going up to ORF100. And for some reason the ORFs are organized in blocks of 19 to 21 consecutive ORFs, where the ORFs within each block have similar functions (even though in reality ORFs are numbered based on their position in the genome, and not so that ORFs with similar functions are given consecutive numbers).

The document McMillan showed was titled Daniel_Santiago_ORF_relationships_Quantum_Codon_Energetics_12_3_25. I don't know if Daniel Santiago was involved in writing the document, or if the document just shows a conversation Greg had about Santiago's theory with AI. "Quantum codon energetics" refers to a nonsensical technobabble theory by Daniel Santiago: [https://www.preprints.org/manuscript/202503.0548]

I don't know if Daniel Santiago is supposed to a member of the "Solution of Scientists" group, but he was featured in Maria Zeee's clot panel together with Hirschman, Greg Harrison, and Wayne Crouch, and he has also done other videos with Hirschman and Harrison, and he was credited as a member of the "scientific research and advisory team" of An Unholy Triad.

But anyway, if McMillan was for real, he should've realized that the story about the mystery ORFs was fake. And in fact even if he would've only watched the first episode of An Unholy Triad, he should've realized that the videos were disinformation. But instead he had little negative to say about the ORFs, and he promoted the ORFs many times on Substack, YouTube, and Twitter, which makes him look like controlled opposition who is deliberately promoting false information.

Therefore it's very telling how it was McMillan out of all people who was contacted by the anonymous cath lab whistleblower, and how McMillan's childhood friend Azzard Comrie was possibly the second person after Ryan Cole who claimed to see the calamari clots during autopsies. In the same way that in 2022 new revelations about the clots were first presented by Jane Ruby, and various whistleblowers contacted Jane Ruby to provide her information about the clots, later on the same role seems to have been occupied by Philip McMillan.


Between January 2024 and May 2025, McMillan did all of these videos about the clots:

Hirschman talking about ORFs with Flashlights in March 2025

In March 2025 when Hirschman was interviewed on a channel called Flashlights, he said this about the mystery ORFs: "And this kind of stuff right here you're going to probably start hearing in the future about - these ORFs, basically what I understand here is these reading frames are manufactured - there's patents apparently on many of them, and some of them we can't even find all of them. But we've got amino sequencings and all that stuff. Basically it's - it seems like it's - this whole thing has been a bioweapon. The whole thing sounds like it's been a bioweapon. And there's been many people - like Karen Kingston's been talking about bioweapons - we all were told that this all just happened in 2019. No, this is something they've been working - they've been working on this kind of stuff for a long time." [https://rumble.com/v6qheaq-white-clots-in-the-dead-and-living-hirschmans-insights-from-4-years-of-post.html?start=8940] When Hirschman said that people have been "working on this kind of stuff for a long time", he might have referred to how Wayne Crouch claims that work on SARS-CoV-2 started in the 1970s in the Soviet Union. [https://puremediaaustralia.org/f/global-conspiracy-exposed-unveiling-the-ultimate-bioweapon]

At time 2:40:01, Hirschman showed the plasmid map below from Patent_SUN's thread, and he said: "On this chart here - which, you know, I didn't create that chart - but that ORF says - this is the spike ORF - ORF11, 7 prion motifs. And on it says mystery ORF19, 23 prion motifs." But to Hirschman's credit, at least he said that ORF11 was the spike ORF, and he showed a real plasmid map of the Pfizer vaccine, and not one of Greg's AI-hallucinated plasmid maps.

People who have promoted An Unholy Triad

Steve Kirsch posted two tweets where he promoted An Unholy Triad: [https://x.com/stkirsch/status/1905489721654165629, https://x.com/stkirsch/status/1907637107239350612]

John O'Looney also promoted An Unholy Triad on Twitter and LinkedIn:

Matt Shelton is the co-founder of NZDSOS, but he was also credited as one of the three executive producers of An Unholy Triad, and as a member of its "scientific research and advisory team". He tweeted this link to a page for An Unholy Triad on PMA's website:

The Unholy Triad videos are so awful that when I wrote this in April 2025, the first part had only about 2,000 views on Rumble and the other parts all had less than a thousand views, even though the view counts on Rumble generally seem to be inflated, and the videos were promoted by big names in alt media, like Steve Kirsch, John O'Looney, and Philip McMillan.

In order to map out who promoted the videos on Twitter, I tried searching Twitter for the Rumble URLs of each episode of An Unholy Triad. There were a total of 36 search results for the URLs, out of which the most URLs were posted by Greg Harrison (13), a user called max_ev_84 (7), Wayne Crouch (5), and Greg's cheerleader CoyoteSanctuary (5):

Episode User Tweets
S1E01 WayneC50256258 1
S1E01 ChakraSeven 1
S1E01 gemoscatelli 1
S1E01 Mister__Q 1
S1E03 WayneC50256258 1
S1E03 AlexGnarcia 1
S1E04 Greg21143362 3
S1E05 Greg21143362 3
S1E06 Greg21143362 2
S2E01 max_ev_84 7
S2E01 CoyoteSanctuary 5
S2E01 WayneC50256258 3
S2E01 Greg21143362 3
S2E01 Fredy13_Backup 1
S2E02 Greg21143362 2
S2E02 thanku4speakin1 1

My table above does not include the tweets by Kirsch, O'Looney, or Shelton, who didn't post links to Rumble, but Kirsch quoted Greg's tweets, and O'Looney and Shelton posted links to the website of Australian National Review.

NZDSOS also promoted the Unholy Triad videos on Twitter, and they wrote that the videos were based on "thousands of encrypted pages" of documents: [https://x.com/nzdsos/status/1894285548929650831]

This is the first release of a planned series of videos based on a new treasure trove of thousands of encrypted pages provided to a small group of doctors and scientists along with the owners of an online news site, Pure Media Australia.

Now successfully being decrypted, so far the information appears largely public domain already, but puts the focus back on the provenance of the so-called virus responsible for the illness labelled Covid-19.

[...]

The encrypted files contained bioweapons language, and document highly specific sequences, called open reading frames (ORFs), in SARS COV-2.

These ORFs are genetic code that make host cells produce proteins which, amongst other things, can cause severe inflammation and clotting, including the highly abnormal white clots that seem to be an amyloid process in the blood itself (amyloid usually affects specific 'solid' organ systems).

Tom Haviland's Substack comment about ORFs

On April 30th 2025 UTC, which was about a month after Greg Harrison had announced that he had retracted his ORF rantings, Tom Haviland posted a comment at Substack that said "Decades of bioweapons research by the Soviets, Chinese, and Americans have developed nefarious ORFs that code for proteins that promote blood clotting, help viruses replicate faster, and help viruses evade the immune system": [https://www.thefocalpoints.com/p/new-study-pfizer-recipients-face/comment/113177574]

The name of the Unholy Triad movies refers to the triad of Soviet Union, China, and United States that supposedly created SARS-CoV-2.

Greg Harrison responds to me via AI

On April 4th 2025 UTC, Greg Harrison announced that "at this point in time, wish to retract my ORF 'rantings' due to our lack of credible evidence that any of our ORF stuff actually exists". [https://x.com/Greg21143362/status/1908007680406589892]

But about a month later, Greg posted the following AI-generated response to me, where he now seems to be saying that his mystery ORFs are real after all. He posted the response as plain text without any formatting, so I attempted to restore the formatting here: [https://x.com/Greg21143362/status/1919629605310497110]

an ode to henji....;

Aiming to systematically deconstruct this mischaracterization and affirm the evidentiary integrity behind each of the conclusions presented in our research - so far and is continuing....

1. ORF Identification and Sequence Integrity

The ORFs in question (ORF11, ORF19, ORF29) are not AI inventions. These sequences have been documented in extended SARS-CoV-2 annotations, including in studies by Jungreis et al. (2021, eLife) and Cagliani et al. (2020, Journal of Virology).

ORF19 in particular has clear homology to adenoviral lipase-encoding regions and shows conservation across various coronavirus genomes. ORF11 and ORF29 exhibit non-canonical initiation codons and overlapping reading frames, a hallmark of viral genomic economy.

2. Experimental Corroboration of Amyloid-Prion Pathology

Our research into embalmer-extracted white clots has used a multi-modal analytical approach:

These confirm that the white clots represent amyloid-prion fibrinaloid masses that are resistant to fibrinolysis and persist under normal pharmacological conditions.

3. Functional Significance of ORFs in Viral Evolution and Pathogenesis

4. AI Integration: Synthesis, Not Hallucination

The AI tool employed has not fabricated novel biology. Rather, it integrates cross-disciplinary inputs:

Such integrations are reproducible, testable, and transparent. Dismissing them as hallucinations without interrogating the input datasets or model logic reflects a fundamental misunderstanding of how advanced AI assists bioscience.

5. Implications for Pathogenic Amyloidogenesis

We now understand that the SARS-CoV-2 genome contains multiple layers of coding capacity, including hidden ORFs that may encode disordered, prion-like peptides. When coupled with:

...we observe a convergent mechanism capable of initiating systemic amyloid-prion fibrinogenesis.

Conclusion

In summary, the findings presented are not the product of speculative AI. They reflect:

Labeling this body of work as "AI hallucination" is not only inaccurate but risks undermining emerging models of cross-disciplinary biosynthetic integration.

We encourage the scientific community to evaluate these findings on their experimental merit and falsifiability, not on outdated notions of computational inference.

Greg's AI told me: "The ORFs in question (ORF11, ORF19, ORF29) are not AI inventions. These sequences have been documented in extended SARS-CoV-2 annotations, including in studies by Jungreis et al. (2021, eLife) and Cagliani et al. (2020, Journal of Virology)." I told Greg that I didn't see any reference to ORFs 11, 19, or 29 in the papers by Jungreis or Cagliani, in case he meant these papers: https://journals.asm.org/doi/10.1128/jvi.00411-20, https://www.sciencedirect.com/science/article/pii/S0042682221000532. So Greg's AI seems to have hallucinated citations about the ORFs while it simultaneously said that the ORFs are not AI inventions.

Greg's AI told me: "ICP-MS/OES revealed consistently elevated phosphorus, tin, and sulfur, aligning with phospholipid nanoparticle exposure." But McCairn said that when he ran EDX on the clots, he didn't find a high level of tin or phosphorus.

Greg's AI told me: "ORF19 in particular has clear homology to adenoviral lipase-encoding regions." I asked Greg: "But what range of nucleotides in Wuhan-Hu-1 is ORF19? And what part of that range has homology to what range of nucleotides in what adenovirus accession?" But he didn't answer me, and he just said I was a troll. I have never seen Greg give a nucleotide range of any of his ORFs in the genome of SARS-CoV-2, and I haven't seen him post a nucleotide or amino acid sequence of any of his ORFs.

Open reading frames are numbered based on their position in the genome and not based on their function. Greg's AI made it seem like an ORF19 in some random adenovirus would have something to do with an ORF19 in SARS-CoV-2, but it's similar to saying that if one street has a restaurant at a building with the street number 19, then you can predict that buildings with the number 19 on other streets are also restaurants.

Greg's AI told me: "The AI tool employed has not fabricated novel biology." But in the same conversation, the AI literally had the chutzpah to fabricate novel biology out of whole cloth.

Top secret press release by Solution of Scientists

In September 2024, Laura Kasner published a PDF document about the clots titled "A New Iatrogenic Disease? a detailed compositional and histopathological analysis of white clots". The cover of the PDF said "Authors remain anonymous for safety reasons", even though Kasner wrote that Greg Harrison was one of the authors: [https://laurakasner.substack.com/p/how-the-white-clots-are-formed]

A version of the PDF with OCR was posted here: https://5nn.info/temp/Sos_Press_Release_August_2024--OCRed/Sos_Press_Release_August_2024-OCRed.pdf.

The document was described as a press release, but it had a big red "TOP SECRET" stamp on the cover page. A "top secret press release" sounds like an oxymoron.

Elemental analysis with ICP-MS

In the PDF for the top secret press release, there was this plot which showed the amount of zinc that was supposedly present in 8 different samples of the clots:

And on the next page, there was this plot that showed that there was 100% or close to 100% variance in the amount of zinc in the samples (even though the ppm values for zinc didn't seem like maximally variable, whatever that would mean):

I don't know how the variance percentage was calculated. When I measured the pixels to approximate the ppm values of zinc in each sample, and I multiplied the variance of the ppm values by 100, the result was about 62, and not 100:

> v=c(102,71,33,55,58,33,46,36)/150*5
> var(v)*100
[1] 61.57937

But I don't even know how you're supposed to calculate a variance percentage that is constrained to the range of 0-100%, because my code above can produce percentages that exceed 100%, and SOS seems to have used some other method to calculate the variance percentages. When I asked ChatGPT how to calculate a variance percent, it suggested this formula:

> sqrt(var(v))/mean(v)*100
[1] 43.395

But that formula can sometimes also produce values above 100%. When I asked ChatGPT how to constrain the values to the range of 0-100%, it suggested the formula: sqrt(var(v))/mean(v)*100. But that also produced a value above 100% for some inputs. Next ChatGPT suggested this formula: var(v)/(max(v)-min(v))^2*100. But that doesn't seem to be any standard way to calculate a variance percentage either.

I asked Greg Harrison multiple times how the variance percentages were calculated, but he never answered me. So I suspect his ICP-MS data may have been fake like his data about the ORFs.

Peptide mapping analysis with HPLC-MS

In addition to performing ICP-MS to analyze the elemental composition of the clots, the anonymous authors at SOS are also supposed to have performed HPLC-MS to analyze the protein composition of the clots. The HPLC results were presented in pie charts like this, which showed the 21 most abundant proteins in 3 clot samples: [https://laurakasner.substack.com/p/how-the-white-clots-are-formed]

The charts only include fibrinogen but not fibrin among the 21 major constitutents. The anonymous authors at SOS wrote:

The authors suspect that Hirschman clots are composed primarily of fibrinogen that has not been converted to fibrin by the action of thrombin.

[...]

A distinctive feature of Hirschman clots is the relative lack of fibrin and the apparent lack of thrombin to convert fibrinogen to fibrin. It is currently unknown whether thrombin is absent, present but somehow disabled, or otherwise inhibited.

In the hypothetical case of synthetic (iatrogenic) clot causation as a result of COVID vaccines, the Spike Protein (produced by the host cells) and the lipid nanoparticles may act as the initiators of the clotting cascade. In the absence of functional thrombin, the clotting cascade may instead utilise partially disassociated fibronectin rather than fibrin, resulting in a long, rubbery clot.

However when I showed one of the pie charts to ChatGPT and asked if the chart should also include fibrin, ChatGPT said:

The mass spectrometry data from your blood clot sample shows high levels of fibrinogen chains - beta, gamma, and alpha - which strongly suggests the presence of fibrin. In a clot, fibrinogen is converted to fibrin by thrombin, which cleaves off fibrinopeptides A and B. However, standard bottom-up proteomics workflows break down proteins into peptides for identification. As a result, the peptides detected from fibrin often look the same as those from fibrinogen unless the analysis specifically targets unique features of fibrin, like crosslinked peptides or missing fibrinopeptides.

What you're seeing in the pie chart is a reflection of this peptide overlap. The data likely includes fibrin, but it's labeled based on its precursor proteins - fibrinogen chains - because most mass spec pipelines don't distinguish between the cleaved (fibrin) and uncleaved (fibrinogen) forms without additional targeted methods. The presence of Factor XIIIa in your data supports the idea that fibrin is present and has undergone crosslinking, which is a key step in stabilizing the fibrin mesh.

To directly confirm fibrin rather than just fibrinogen, you would need to identify specific crosslinked peptides, like γ-γ or α-α chain dimers, or the absence of fibrinopeptides A and B. These are challenging to detect without specialized workflows, but they would definitively indicate fibrin formation.

So when the anonymous authors at SOS wrote that "Hirschman clots are composed primarily of fibrinogen that has not been converted to fibrin", the authors may have been confused by how the mass spectrometry results only included fibrinogen but not fibrin.

When I looked up a random study where the authors analyzed the protein composition of fibrin clots using quantitative liquid chromatography mass spectrometry, fibrin was not listed as a major component of the clots, but only fibrinogen and fibronectin: "Among 494 clot-bound proteins identified in all clots, the highest concentrations were for fibrinogen chains (about 64% of the clot mass) and fibronectin (13%). α2-antiplasmin (2.7%), factor XIIIA (1.2%), complement component C3 (1.2%), and histidine-rich glycoprotein (HRG, 0.61%) were present at relatively high concentrations. Proteins present in concentrations <0.5% included (pro)thrombin, plasminogen, apolipoproteins, or platelet factor 4 (PF4)." [https://www.sciencedirect.com/science/article/abs/pii/S1874391919302593]

I have busted SOS presenting AI-generated data as real, so their HPLC data might have also been generated by AI. I told ChatGPT: "generate fake mass spec proteomics results of a fibrin blood clot sample which shows percentage of each protein". It produced this table which looks somewhat similar to the results by SOS, and it's also missing fibrin but it only includes fibrinogen and fibronectin:

McCairn asked Greg to publish his raw files of the mass spectrometry data, but Greg said something to the effect that he was not able to provide the files because it might have risked identifying the instrument or analyst who performed the analysis, and he himself only had access to summary data similar to the pie charts. But if the analyst did not want to provide the raw files, couldn't Greg have just asked the analyst to share more detailed data as a CSV file or something?

On Kevin McCairn's Discord there's a user called Centropede who is familiar with mass spectrometry, but he thinks Greg's mass spectrometry data is probably fake:

Greg Harrison tweeted: "Janie, just a cautionary note pls - my work simply cannot be validated due to confidentiality required by the Institutions who did the work at our expense - they demanded we must never reveal the actual data provided as it will out them. Therefore none of our work can be substantiated as we are no longer involved in the early Solution of Scientists stuff etc - just saying". [https://x.com/Greg21143362/status/1915897815123038680] In the same thread he wrote: "My PhD students who performed the actual analyses have yet to complete their respective PhD's at their respective Universities - this will never be compromised". [https://x.com/Greg21143362/status/1915900656420057495] In another thread he wrote: "That's correct...no point continuing when we cannot furnish actual data for fear of compromising younger bright students who had quiet support from over-seeing professor asking for permanent anonymity 🥺". [https://x.com/Greg21143362/status/1915948691447533703]

I showed Greg tables of real HPLC-MS data, and I told him: "You don't even have to publish the raw files but you could just publish tables like this as Excel or CSV files. It wouldn't identify the people or institute that performed the analysis." [https://x.com/henjin256/status/1916552977600467261] But he replied: "No,No, No...this won't fly either - because I already sent multiple XL sheet copies & these were not enough for verification without the original data 😂". And he continued: "The problem is that the original data is stamped & signed by the over-seeing professors who demand anonymity...no more & no less, hence we done & dusted.." But I replied: "By 'multiple Excel sheet copies', do you mean spreadsheets that just showed the percentage of each protein like your pie charts? Don't you have more detailed data available? It wouldn't compromise anyone's anonymity any more than your pie charts do." Then he posted the image below and said "just a sample...counts...": [https://x.com/Greg21143362/status/1916697488955748823]

Then I asked Greg "What are the column headers?" But he said: "Proprietary...😂" And I asked: "Is the third or fourth column supposed to show the count in the second column as a percentage of the total count?" But he didn't answer.

But the 5th column looks like a cumulative sum of the 4th column. When I took the table on the left and I tried reverse engineering the total count by dividing the counts in the 2nd column by the percentages in either the 3rd or 4th column, the 3rd column gave me a lower mean absolute deviation, which suggests that the 3rd column might show some kind of raw percentages of the counts but the 4th column might show adjusted percentages of the counts. But if the data is fake, then all columns of the table might have plausibly been generated based on a list that just showed the name and percentage of each protein. If Greg cannot even reveal what the columns in his table mean, he doesn't inspire much confidence in the authenticity of his data.


Added later: When I later asked Greg to post the column headers again, this was his response: [https://x.com/Greg21143362/status/1919716879226073391]


During an interview with Nicolas Hulscher in May 2025, Greg said: "The analysis results were conducted again by two different separate labs. And unfortunately - this is where I've been roundly critizized by public media - but I cannot furnish the actual data and the findings. Because one of them for example is written in a foreign language, which had to be translated. And the second, one of course - there are markers in there that will identify the universities. Now, this has been done in two universities, and the two universities have both stipulated - because one of my colleagues is actually studying a PhD in protein chemistry at one of these universities - that the can have access to this equipment. So, he was able to run all these tests. And we even had him - Richard was saying that - sign a certificate stamped by the university, hand-signed by the overseeing professor, that 'I am forbidden to show and demonstrate this original data. All I can do is present the findings, in spreadsheet, and all the interpretations that we've got.' But when a scientist asks, 'I want to see your actual data.' I have to politely refuse, and say, 'I cannot do this.' One, because the university said they don't want their names mentioned, because of the nature of this work. Secondly, because I were working on human-type tissue - if you like - even though they were discarded. They are very nervous about this kind of work." [https://x.com/McCulloughFund/status/1920255597993189611, 23:39] So I asked Greg if the person at the other lab also signed an agreement, or why couldn't they share the data either? And I said he wouldn't even have to share the raw data but just a detailed spreadsheet of the results, which wouldn't identify either the person or the university. But Greg didn't answer.


Added in May 2025: I asked Greg: "If the student who supposedly did your HPLC-MS analysis was doing a PhD degree in protein chemistry, didn't they tell you that fibrin doesn't normally show up in HPLC results but only fibrinogen?" [https://x.com/henjin256/status/1921660804463517817] But he didn't answer me and he blocked me.

Clot from a tube for removing lung fluid presented as a clot from a COVID patient

The press release by SOS included this image with the caption "Worm-like fibrous clot from a patient who died from COVID disease":

The same image was featured in a paper published in 2019, which said it was a clot from a pleural catherer: [https://www.researchgate.net/figure/Long-fibrin-clot-completely-occluding-the-catheter-lumen-of-an-Indwelling-pleural_fig3_334522712]

A pleural catherer is a tube that drains fluid from the pleural space, which is the space between two membranes that surround the lungs:

Greg Harrison

Interview of Greg Harrison and Tom Haviland by Flashlights in April 2025

On April 7th 2025 UTC, a Rumble channel called Flashlights published an interview of Greg Harrison and Tom Haviland. [https://rumble.com/v6rq775-do-mrna-covid-shots-cause-the-misfolding-of-proteins-in-humans-greg-harriso.html] I don't know if the interview was recorded earlier, because Greg was still talking about his ORF hoax in the interview, even though on April 4th UTC he tweeted that "And at this point in time, wish to retract my ORF 'rantings' due to our lack of credible evidence that any of our ORF stuff actually exists." [https://x.com/Greg21143362/status/1908007680406589892]

Tom Haviland seemed to support the story about the ORFs, and he said: "But in the open literature you'll only see papers that like identify the SARS-CoV-2 virus from ORFs 1 through 10. And then it stops there as if that's the entire length of the code, that's all. What Greg is saying there seems to be evidence that there's more ORFs - more open reading frames - than what has been published in these published papers." [1:09:06]

During the video, Greg also said: "So, the HPLC analysis we did, though the gentleman by the name of Dr. Arne Burkhardt who had also done the same work on Richard's white clots by I think two years before us. And he used a technique called MALDI-TOF. And MALDI-TOF is an older technique - it's not quite as definitive as the technique we used, which is HPLC - and Dr. Burkhardt got over 300 different proteins in those white clots. He also noted - he did some other histology tests on it with Congo red - and he found - and he determined there was amyloid presence in his samples. Now, unfortunately, Dr. Burkhardt had met an untimely death. His work has been suppressed. We haven't been able to get a copy of his analysis, because I'd like to compare it with the analysis we have." [15:06]

Then the host asked: "You said that you tried to get a copy of his analysis and you couldn't. How is that possible? I mean, it wasn't it that was at a published paper, or why couldn't you get a copy of the paper?" And Greg answered: "Yeah, Arne Burkhardt had the same problem. We've got the people who supposedly conduct his MALDI-TOF work did not want their identities released. And, we'd have - Dr. Ryan Cole, I think, has had some success trying to locate some of these people to confirm his results. But end of the day, the results were not - exactly the same reason I've got, where the professors who have done the work using their MALDI-TOF equipment don't want their names out, because they're frightened of the blowback that may occur to the universities."

But Greg's explanation doesn't make sense, because couldn't Burkhardt have just published the results of the analysis without having to publish the names of the researchers who did the analysis?

One suspicious thing about Burkhardt is that he didn't present his findings in a proper scientific format but in videos that were aimed at a mass audience. I think the closest to a scientific paper he wrote was a short report he coauthored with Sucharit Bhakdi, but it was basically just a textual summary of a video that Burkhardt did with Bhakdi. [https://doctors4covidethics.org/wp-content/uploads/2021/12/end-covax.pdf] Bhakdi's organization Doctors for COVID Ethics organized a series of symposiums that featured presentations by nanobot guys like David Hughes, Daniel Broudy, and Shimon Yanowitz. [turbo.html#Images_from_Burkhardts_conference_promoted_by_David_Hughes_and_Matt_Shelton] People in Burkhardt's pathology conference said that vaccines contained graphene oxide, minirobots, parasites, and objects that looked like SIM cards, and that the blood of a vaccinated person contained a synthetic fiber that may have been a Morgellons fiber. [turbo.html#German_pathology_conference_held_by_Arne_Burkhardt] But if Burkhardt is supposed to have analyzed the calamari clots in a lab, it's a further reason to be suspicious of him.

But anyway, during the interview with Flashlights, Haviland also said this about McCairn: "And the next step that he's talking about is very important because we want to see whether, uh, we could take some of the ground-up sample of the white fibrous clot, and then, uh, put that into solution, inject it into animals - test animals such as hamsters, rhesus monkeys - and see if there's this prion activity, right. If that animal develops a white fibrous clot. In other words, is the white fibrous clot material contagious, infectious? Is it seeding? Does it, then, you know, does it plant itself in this vascular system and then grow and form a white fibrous clot to kill the animal? And we want to see if that happens, and if it does happen, how quickly does it happen. Because then that - you know, if, and if it does, that's, you know, even more alarming, right? Because it proves the presence of prion material in these white fibrous clots." [1:30:55]

Kevin McCairn told me: "You seem incapable of understanding that I am working independently and the only link is that is that Greg claims to have done some investigation on the clots. What he has done has nothing to do with my lab analysis." [https://discord.com/channels/872999209182322719/1064054153183236146/1358510136867684532] So I asked McCairn why Haviland said that McCairn's hamster experiment was an experiment done by "we"? But McCairn told me: "Because he's talking out of his ass, I do not have any formal relationship with them beyond receiving the clot samples and discussing what I would be doing with the samples for analysis. If they start paying me for the work, I will let you know." However I suspect McCairn wanted to distance himself from Harrison and Haviland after I busted their ORF hoax.

During the interview with Flashlights, another interesting thing Greg said was: "I've also been in contact with New Zealand embalmers and also John O'Looney in the UK. And so we've got - and also one Laura Jeffery from Canada - so we've got four embalmer, four different countries, all confirming they're seeing these white clots." [4:26] And a bit later he said: "The hard analyses that we've done on Richard Hirschman's clots, and also on some clots out in New Zealand, down through Brenton Faithfull, ok - so we're matching up New Zealand clots, US clots - and I was hoping to get some samples from John O'Looney in UK, and also some samples out of Canada, from Laura, they've yet to arrive." [11:10]

So Greg is supposed to be getting clots from 4 embalmers, 3 of whom were featured in a Stew Peters movie. And the 4th one is Laura Jeffery, who has appeared in videos by VSRF, and she helped Haviland with running at least one of his surveys, and she claimed that the white clots resembled parasites and they seemed to be feeding off the currant jelly clots. [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf] All 4 embalmers have done videos in alt media where they have made ludicrous claims. Brenton Faithfull said that after he first started keeping records in August 2021, 39 out of the first 40 dead people who passed through his funeral home had been vaccinated less than 2 weeks before their death. And John O'Looney claims that vaccines contain nanobots that are activated by 5G. And when Ana Mihalcea said there were quantum dot micro robots in Hirschman's coffee ground clots, and she showed a microscope video of Brownian motion as evidence, Hirschman said "you got some pretty daggum solid proof behind you when you're showing the actual images, you're showing the blinking lights".

Richard Hirschman's connection to Greg Harrison

Richard Hirschman has done all these videos together with Greg Harrison (the dates are in UTC):

Even after I busted Greg's ORF hoax in March 2025, Hirschman has kept touring the alt media circus with Greg. McCairn told me he had informed Hirschman about how Greg was a fraud, but for some reason Hirschman doesn't seem to have a problem doing videos with Greg: [https://x.com/KevinMcCairnPhD/status/1928128047515062379]

McCairn keeps telling me that his analysis doesn't have anything to do with Greg's fake ORFs, and McCairn claims to be independent of Greg. But McCairn is supposed to have received his clots from Richard Hirschman, who appears to be part of the same disinformation operation as Greg. Tom Haviland wrote that Greg was the "lead scientist" of a team that was analyzing the clots, and that Greg asked Hirchman to send the clots to McCairn, and that Greg asked McCairn to check the clots for the presence of prions. [https://laurakasner.substack.com/p/a-horrifying-breakthrough-in-the]

AI-generated plot of Raman spectroscopy results

During an interview with Nicolas Hulscher, Greg Harrison showed this AI-generated plot that was meant to represent Kevin McCairn's Raman spectroscopy analysis of the clots, and Greg said: "That's the overlay - again this is an AI overlay of the actual graph": [https://www.thefocalpoints.com/p/microscopic-and-biochemical-analysis]

Hulscher included the plot in his Substack post and tweet about the interview, but he didn't indicate that the plot was AI-generated.

McCairn said on Discord that Greg "has in fact got the raw data wrong that I have generated".

Hulscher's tweet also included a table of Greg's HPLC mass spectrometry results, but McCairn replied that the results should be ignored since Harrison is unable to publish the raw files of his HPLC analysis: [https://x.com/KevinMcCairnPhD/status/1920577333070868966]

In Greg's plot, the peaks all have a uniform shape, and the baseline level outside of the peaks is constant. But raw Raman spectroscopy data looks more noisy, and the level outside the peaks is more variable (even though there's also plots that look more like Greg's plot because they show smoothed curves that were fitted against the raw data, like the bottom left plot below): [https://www.google.com/search?q=raman+spectroscopy+plot&tbm=isch]

When I told ChatGPT to generate a plot of Raman spectroscopy results, it generated data with similar smooth curves as Greg's plot:

Ethics protocols prevent sending clots to Doug Kell

In May 2025, Greg Harrison posted this reply to a tweet by Doug Kell: "Its such a pity that ethics protocol's prevent our embalmers actually sending you samples of embalmer white clots freshly extracted and preserved both under Argon & in formalin, for amyloid presence confirmations...a missed opportunity if ever there is one...:cry:" [https://x.com/Greg21143362/status/1920431081104248925]

I posted the tweet on McCairn's Discord. And I asked why didn't the ethics protocols prevent the embalmers from sending clots to other people? Do the ethics protocols only come into play when someone who might not be in on the scam asks to analyze the clots?

But McCairn posted this reply to me, which does make sense to some extent: "It's an institutional requirement that there be informed consent for any data to be published. In this case there is no informed consent, it's taking waste that would otherwise go down the drain. As a private lab I don't have to be bound by the same requirements as a University or hospital as I'm just conducting analysis with no identification as to the individual, and I will not publish it in a journal, until informed consent is obtained."

Mike Adams

Video about clots with Jane Ruby in July 2022

In July 2022, Mike Adams did a video about the clots with Jane Ruby. [https://rumble.com/v1dorkz-07-26-22-dr.-jane-ruby-and-the-health-ranger-reveal-post-vaxx-clot-mysterie.html]

At time 1:32, Mike Adams said that Stew Peters is a treasure for humanity.

At time 13:20, Jane Ruby said: "Dr. Van Welbergen said - he literally watched, he's got videos, he's going to show us, eventually, but he's - he watched under the microscope, these structures pull graphene from another part of the blood. It's almost like it's got a magnetism and then pulls it into itself so that it can enlarge. I want to give you another piece of information that's - it could be a part of this or not - but Mr. Hirschman, several weeks ago, said to me that he went back to his lab refrigerator to put some additional samples in. And he said that the - there were several baggies where he - he had to look twice and he thought that they were bigger. And so he turned to his wife who helps him in the lab, and he said, 'Am I, you know, crazy or are these enlarged?' So I asked him - I try to qualify it with him - 'What do you mean enlarged? Like, are we talking 10, 20 percent?' He said, 'No,' he said, 'Dr. Ruby, they're - they're like two to three times larger.' And I said, 'Well, what kind of timeframe are we talking about?' And he said 'Several days.' And like these were - these particular samples were in formalin. So the formalin is not - which is a preservative for the audience's sake - this formalin is not discouraging the growth, it's not stopping it. So these, these, this information - I think Dr. Van Welbergen said that there's an intelligence - there's an intelligence to this graphene. It has a mission and it seems to be working when it's viewed under a microscope."

I don't remember Hirschman later saying that clots double or triple in size after they are removed from a body, and I don't remember other morticians making similar statements either. So that seems to be one of the more fantastical features that was initially part of the story about the clots but that was later dropped, similar to the feature that the clots are parasites that feed on the red clots, or that the clots form electric circuits that enable killing people with 5G. The story about the clots has been more successful than other Stew ops, but I think it's partially because the story of the clots is more mundane than other Stew ops, partially because some of the more fantastical features of the story were dropped over time.

But anyway, next at time 17:26, Jane Ruby talked about the video where ball bearings in castor oil assembled into wires, and she claimed that the video showed graphene self-assembling. And then Mike Adams said: "Graphene is primarily made of carbon. And, and, so carbon is what we're seeing in a higher concentration in the clots compared to human blood."

At time 23:18, Mike Adams said that he saw "nanowire interface structures" in the clots at 1,500-fold magnification: "That nanowire type of structure was embedded in the clot. It was not a contamination. It's not one of my own hairs, for example, that fell into the microscope. It was there, it was attached. And, you know, perhaps we could even, if we rehydrate that sample, we could look at the attachment point and get a little more detail on that. But you're right, at 1,500 magnification, we were able to see these - what you might call nanowire interface structures - kind of like the edge of a circuit board, like an interface that you plug into your PC and it's got all these wires on the edge that talks to your CPU - it was like that was lining the top of this nanowire. And again, you and I are using these terms descriptively, we don't - we're not saying that for sure these are absolutely circuit boards, but that's what they resembled. So it's a mystery."


Jane Ruby later compared Mike's nanowire to a mysterious structure from Lee and Broudy's paper in IJVTPR: [https://x.com/RealDrJaneRuby/status/1821247988867412430]


In July 2022 when Jane Ruby interviewed Hirschman, she told him that she believes the "fibrous hairs" that Mike Adams saw in Hirschman's clots are part of self-assembling nanoparticles: "He's gotten it up to 1,500 times magnification. We've seen circuitry, and we've seen, you know, just some astonounding materials - fibrous hairs and things - that we believe are part of the self-assembling nanoparticles." [https://www.brighteon.com/f2735f15-41d9-4bb0-aa83-98625a38d4a4] However Hirschman didn't challenge her statement or have anything critical to say to her.

Image of a clot from 2018 presented as a novel clot

In July 2022, Natural News published an article about a video where Mike Adams discussed his laboratory findings with Jane Ruby. The article included this photo of a blood clot: [https://www.naturalnews.com/2022-07-27-post-vaccine-clots-contain-detrimental-amounts-metals.html]

Ariana Love had earlier said that the same photo showed "a blood clot with Hydra-like mutational growth that was removed from the heart of an early teen who received a Covid vaxx": [http://web.archive.org/web/20221118203650/https://ambassadorlove.blog/2021/11/01/transgenic-hydras-parasites-a-biological-weapons-system-for-rapid-human-cloning/]

But actually the photo showed a clot from the right lung of a heart failure patient from 2018: [https://empr.com/home/news/heart-failure-patient-coughs-up-bronchial-tree-shaped-blood-clot/]

Interview with Jane Ruby in August 2022

In August 2022, Jane Ruby interviewed Mike Adams in a video titled "SHOCKING: White Embalmer Clots Are Self Assembling Circuits". [https://rumble.com/v1glsch-live-7pm-shocking-white-embalmer-clots-are-self-assembling-circuits.html]

Mike Adams said: "These clots are not made of blood, and they do not contain the elements that are common to human life. What they do contain in higher amounts - compared to human blood - are elements that you might find in circuitry or machinery, or electrically conductive systems." [12:43] Next he said that the clots are self-assembling machines: "As you know, they are self-assembling biostructures. So they increase in size over time. And as they're increasing in size, they are accumulating - or harvesting from the blood - these electrically conductive elements that we've mentioned - tin, aluminum and sodium in particular. So in other words, these are self-assembling machines of some kind that are biologically, quote, 'compatible' for a period of time." [16:57]

Next Mike Adams speculated that in a similar fashion that an EMP weapon can destroy an electric circuit, the clots might enable killing people with a directed energy weapon: "We know that, you know - how EMP weapons work is they use an external electromagnetic field of very high energy in order to through induction cause intense heat in circuits to where those little tiny circuits melt, and then that circuit board fails. This is one of the ways that EMP weapons take out, you know, electronics circuit board control systems and so on. The question is, through the use of external electromagnetic fields or even DEW directed energy weapons, is it possible to induce very high heat in these clot structures because they have much higher levels of conductive elements? And is it possible then that these clots could be heated to cauterize the blood vessels, or to cook someone's blood vessels from the inside? And that would cause an instant blockage of blood flow, and that could also be directed at crowds or individuals potentially." [25:12]

Claim that clots contain electric circuits that may enable killing people remotely by 5G or DEWs

In August 2022, Mike Adams published a video where he said: "We noticed something really strange, kind of alarming - and it's going to lead us down a deep, dark, Alice in Wonderland rabbit hole - and we noticed that some elements were higher in the clot than what they are in human blood. And three of those elements that are higher are sodium, tin, and aluminum. These three elements are all very good conductors of electricity, very good conductors of electricity." [https://www.naturalnews.com/2022-08-21-graphene-radio-frequency-electronics-biological.html, 4:30]

And he said: "Here's what's shocking: the clot is harvesting certain electrically conductive elements out of the blood and using those elements in its machinery - however you want to describe it - mechanism to assemble itself to grow its own size and mass, while concentrating electrically conductive elements into some form that we don't yet fully understand. So the shocking takeaway from this is that the clot is very very low in elements that are associated with human life, but the clot is much higher in elements that would be associated with artificial life built by machines." [6:31]

Next he said the clots may have utilized the kind of technology that Charles Lieber was working on, like "nano-circuitary that is interfacing with biological systems, and self-assembling inside the body and interfacing with cells, and even inside the cell membranes for monitoring and control systems". [9:00]

Next Mike Adams said the clots may have acted in a similar manner as RFID tags, and he said: "So what we know from RFID is that if you have a pattern of circuitry, it can respond to external electromagnetic impulses or radiation. In addition, we know from studying EMP weapons and solar flares and so on, that circuits can be made very, very hot, when there's enough external energy directed at them. In other words, the circuits kind of funneled the energy of the electromagnetic broadcast, and it can create a lot of heat. And this is what fries the microcircuitry in devices during an EMP attack. There's too much voltage that is, well, inductive current that goes through the circuits, they get too hot, and then they melt." [12:27] And next he said the clots might similarly cause people to die if there is an EMP or a solar flare, and the clots would enable killing people remotely with directed energy weapons or 5G because the circuitry in the clots would generate so much heat.

He said: "Well, what happens if those clots are heated by some external electromagnetic event, which again could be a solar flare - could be EMP weapon, could be a broadcast, you know, you start to ask questions - are 5G towers capable of this? What kind of broadcast systems could induce current and heat inside the clots? Well, at a certain point, a certain temperature in that clot, it's going to cook the blood vessel in which it resides." [15:57]

He also said: "There was a video, came out a while ago - and to this day, I don't know if that video was a hoax or something real - but it appeared to depict someone in Brazil who reportedly was vaccinated and was hit with one of these weapons and smoke - at least in this video, it may have been fake, we don't know if this is real - but in the video, smoke began to pour out of his eyeballs and his brain cooked from the inside. Now, I don't have that video. It appears to have been completely scrubbed off the internet, but I did see it."

Mike Adams didn't directly mention graphene during his video, but Natural News published an article about the video by someone called Ethan Huff, who wrote: "The 2014 study mentioned earlier discusses how graphene is used to create tiny circuit boards of microscopic size that enhance the conductivity and use of other metals. Could it be that Fauci Flu shots are self-assembling tiny circuit boards from metals siphoned from the blood, resulting in clots?" [https://www.naturalnews.com/2022-08-21-graphene-radio-frequency-electronics-biological.html]

Elemental composition analysis with ICP-MS

In August 2022 Mike Adams published an analysis of Hirschman's clots with ICP-MS (inductively coupled plasma mass spectrometry). In the original post about the ICP-MS results, carbon and calcium were missing, and the concentration of chlorine was erroneously shown as ppm instead of ppb. [https://www.naturalnews.com/2022-08-17-elemental-analysis-results-released-vaccine-clot-composition-not-blood-clots.html] But two weeks later, Epoch Times published this table where the error was fixed, and calcium and carbon were added (even though the table was missing some minor elements that were included in the PDFs of the full-quant results that Mike Adams had posted earlier): [https://www.globalresearch.ca/embalmers-have-been-finding-numerous-long-fibrous-clots-lack-post-mortem-characteristics/5792728]

Mike Adams is supposed to have employed a sample of unvaccinated blood as a control, which is not really comparable to the clot in case the clot is mostly made of fibrin and not blood. But anyway, the only elements which differ by more than an order of magnitude between the clot and control samples are magnesium, potassium, and iron, which are all more than an order of magnitude lower in the clot than in the control sample. Mike Adams noted the low levels of iron and potassium when he wrote: "One conclusion is inescapable: The clot is almost entirely lacking key marker elements that would be present in human blood (such as iron and potassium) yet shows significantly higher concentrations of elements that are used in electronics and circuitry."

However he failed to point out that his control sample had very high levels of aluminum and tin. A book about the toxicology of aluminum said: "Normal levels of aluminum in serum are approximately 1-3 μg/L" (i.e. 0.001-0.003 ppm). [https://www.atsdr.cdc.gov/toxprofiles/tp22-c2.pdf] A book chapter about aluminum toxicity says that "serum levels above 200 µg/L are usually associated with clinical symptoms and signs of toxicity". [https://www.sciencedirect.com/topics/immunology-and-microbiology/aluminum-blood-level] But 200 µg/l is 0.2 ppm, so Mike's control sample had about 8 times the toxic level of aluminum. And also in one study, a normal baseline level of tin in blood was about 8.4 μg/L, which is about 0.0084 ppm, but the level of tin in Mike's control sample was about 20 times higher. [https://www.sciencedirect.com/science/article/abs/pii/S0009912012005504]

In the table below, I included a column for a typical ppm level of each element in human blood, which also shows how the control sample has an extremely high level of aluminum:

# Element Control Clot Typical Clot/Control Control/Typical Clot/Typical
12 Magnesium 35 1.7 20 0.05 1.8 0.09
19 Potassium 1893 12.5 150 0.007 13 0.08
26 Iron 462 20.6 1000 0.04 0.5 0.02
29 Copper 1 0.3 1.0 0.3 1.0 0.3
30 Zinc 7.9 2.4 1 0.3 7.9 2.4
13 Aluminum 1.3 1.6 0.002 1.2 650 800
11 Sodium 1050 1500 3250 1.4 0.3 0.5
6 Carbon 137 153 300 1.1 0.5 0.5
20 Calcium 74 23.8 95 0.3 0.8 0.3
50 Tin 0.163 0.943 0.0084 5.6 19 112
17 Chlorine 930 290 3600 0.3 0.3 0.08
15 Phosphorus 1130 4900 35 4.3 32 140

It's weird how Mike Adams is only supposed to have employed one unvaccinated blood sample as a control. He could've at least taken the median of 3 samples or something, because his control sample might have had an unusual level of some elements. Or if his equipment was contaminated, he might have been able to detect it if he ran multiple control samples but they all got an unusually high level of some element, like aluminum or tin.

I thought that maybe Mike Adams accidentally reported the level of aluminum as 1.3 ppm even though the level was supposed to be 1.3 ppb. But this table also shows that the level of aluminum was supposed to be about 1341 ppb in the control sample: [https://www.naturalnews.com/2022-08-17-elemental-analysis-results-released-vaccine-clot-composition-not-blood-clots.html]

In the post I linked above, there's links to PDFs which show the ICP-MS results of some additional elements that were missing from the table at Epoch Times. [https://www.naturalnews.com/files/CWC-Blood-Test-ICPMS-results.pdf, https://www.naturalnews.com/files/CWC-Clot-Test-ICPMS-results.pdf] I included the results from the PDFs in the next plots:

t=fread("group,element,name,control,clot,typical
Alkali/alkaline earth metals,Mg,Magnesium,35495.372,1665.925,20000
Post-transition metals,Al,Aluminum,1340.926,1576.237,2
Alkali/alkaline earth metals,K,Potassium,1893465.535,12489.148,150000
Transition metals,V,Vanadium,63.192,24.804,0.3
Transition metals,Cr,Chromium,141.959,87.809,0.5
Transition metals,Mn,Manganese,60.151,48.348,1
Transition metals,Fe,Iron,461937.474,20628.016,1000
Transition metals,Ni,Nickel,150.930,177.544,0.2
Transition metals,Cu,Copper,1078.000,300.832,1500
Transition metals,Zn,Zinc,7921.811,2411.749,1000
Post-transition metals,As,Arsenic,23.955,73.708,0.02
Non-metals,Se,Selenium,334.425,241.310,70
Alkali/alkaline earth metals,Sr,Strontium,206.405,166.406,0.3
Transition metals,Mo,Molybdenium,24.187,61.011,0.2
Post-transition metals,Cd,Cadmium,30.071,27.65,0.05
Alkali/alkaline earth metals,Cs,Cesium,17.920,4.874,0.005
Post-transition metals,Pb,Lead,66.263,23.154,35
Actinides,U,Uranium,3.608,1.503,1
Alkali/alkaline earth metals,Na,Sodium,1050000,1500000,3250000
Non-metals,C,Carbon,137000,153000,300000
Alkali/alkaline earth metals,Ca,Calcium,74000,13800,95000
Post-transition metals,Sn,Tin,163,943,8.4
Non-metals,Cl,Chloride,930000,290000,3600000
Non-metals,P,Phosphorus,1130000,4900000,35000")

t[,group:=factor(group,c("Non-metals","Alkali/alkaline earth metals","Transition metals","Post-transition metals","Actinides"))]

a=t[,.(control=sum(control),clot=sum(clot),typical=sum(typical)),.(group,name=sub("-.*","",name))]
a=a[!is.na(control)&!is.na(clot)]

p=a[,.(group,name,x=c(control,typical,typical)/1e3,y=c(clot/control,clot/typical,control/typical),facet=rep(1:3,each=.N))]
xtit=c("Control blood sample ppm","Typical ppm in human plasma")[c(1,2,2)]
ytit=c("Ratio between Hirschman clot and control blood sample","Ratio between Hirschman clot and typical plasma","Ratio between control blood sample and typical plasma")

breaks=10^(-10:10)

lab=sub("\\+0","",sub("-0","-",sprintf(ifelse(breaks<0.01,"%.0e","%.3g"),breaks)))

for(i in 1:3){

ggplot(p[facet==i],aes(x,y))+
geom_vline(xintercept=0,linewidth=.4,color="gray60")+
geom_hline(yintercept=1,linewidth=.4,linetype="42")+
geom_point(aes(color=group),size=.6)+
ggrepel::geom_text_repel(aes(label=name,color=group),size=3.5,max.overlaps=Inf,segment.size=.3,min.segment.length=.2,box.padding=.07,show.legend=F)+
labs(title="Analysis of Hirschman clots published by Mike Adams",x=xtit[i],y=ytit[i],subtitle="Source: naturalnews.com/2022-08-17-elemental-analysis-results-released-\nvaccine-clot-composition-not-blood-clots.html")+
scale_x_log10(limits=range(p$x),breaks=breaks,labels=lab)+
scale_y_log10(limits=range(p$y),breaks=breaks,labels=lab)+
coord_cartesian(clip="off")+
guides(color=guide_legend(ncol=3,byrow=F))+
theme(axis.text=element_text(size=11,color="black"),
  axis.text.x=element_text(margin=margin(3)),
  axis.ticks=element_line(linewidth=.4,color="black"),
  axis.ticks.length=unit(4,"pt"),
  axis.title=element_text(size=11),
  axis.title.x=element_text(margin=margin(3)),
  axis.title.y=element_text(margin=margin(,2)),
  legend.background=element_blank(),
  legend.box.spacing=unit(0,"pt"),
  legend.key=element_blank(),
  legend.key.height=unit(13,"pt"),
  legend.key.width=unit(16,"pt"),
  legend.position="top",
  legend.spacing.x=unit(2,"pt"),
  legend.spacing.y=unit(0,"pt"),
  legend.margin=margin(,,4),
  legend.text=element_text(size=11,vjust=.5),
  legend.title=element_blank(),
  panel.background=element_blank(),
  panel.border=element_rect(fill=NA,linewidth=.4),
  panel.grid.major=element_blank(),
  plot.margin=margin(4,11,4,4),
  plot.subtitle=element_text(size=10,margin=margin(,,2)),
  plot.title=element_text(size=11,face=2,margin=margin(1,,4),hjust=0))
ggsave(paste0(i,".png"),width=5.5,height=4.5,dpi=300*4)
system(paste0("mogrify ",i,".png -trim -resize 25% -bordercolor white -border 30 -colors 256 ",i,".png"))

}

In the last plot above where Mike's control sample is compared against typical ppm in human plasma, there's a diagonal cline from the top left corner to the bottom right corner, which means that elements with a low typical ppm level in human plasma tend to have a relatively high level in Mike's control sample. There's also a similar cline in the middle plot, where the clot is compared against typical ppm in human plasma. I thought the high level of the rare elements might have been due to a limit of precision of the instrument, but ChatGPT said it was not likely and that contamination was a more likely explanation.

In the last plot above, another thing that stands out is that the control sample has a relatively low level of chlorine, sodium, and carbon, which are the three elements that would typically be the most common in human plasma.

Analysis of Jane Ruby's chemtrail fog by Mike Adams

In 2022 after Jane Ruby asked Hirschman to send his clots to Mike Adams, Mike Adams became the first person to present a laboratory analysis of the calamari clots. He supposedly found a high level of metals in the clots with ICP-MS, and he found scary structures in the clots under a microscope.

Three years later in 2025, Mike Adams said that during a period when a mysterious fog was observed in Florida, Jane Ruby had collected matter that had fallen on a sheet of plastic in her garden, and she sent a sample of the matter to him. Mike Adams said that he found a high level of metals in the sample with ICP-MS, and when he looked at the sample under a microscope, he found "biological life forms": [https://x.com/HealthRanger/status/1907475744823107864]

Mike Adams also said that people are being mass-poisoned by weaponized fog, and he posted a microscope photo of this blue structure that people on Twitter said was a Morgellons filament: [https://x.com/HealthRanger/status/1908402667396669751, https://x.com/lex_is_lex_/status/1907591417758638446]

Mike Adams also wrote that he had found a structure in the mystery fog that had "parallel lines that connect like circuitry", which is reminiscent of how in 2022 he said that the clots contained electric circuits: [https://x.com/HealthRanger/status/1907960000862892179]

A week later, Mike Adams reported that he had now found early signs of life forming in Jane Ruby's mystery fog: [https://x.com/HealthRanger/status/1910466399689941312]

After 3 weeks of incubation, Mike Adams found "two distinct living entities swimming across the petri dish": [https://x.com/RealDrJaneRuby/status/1917552049668882920]

Mike Adams also published an ICP-MS analysis of the mystery chemtrail fog, similar to his ICP-MS analysis of the calamari clots: [https://x.com/RealDrJaneRuby/status/1916850734101942617]

In 2017 Clifford Carnicom published a supposed ICP-MS analysis of Morgellons filaments from chemtrails, where he found a high level of aluminum, calcium, and iron. [https://carnicominstitute.org/environmental-filament-project-metals-testing-laboratory-report/] Later Carnicom became one of the first people who is supposed to have done a laboratory analysis of the calamari clots.

The story about the toxic mystery fog is a new conspiracy theory that emerged in December 2024. Jane Ruby was one of the first people to promote the story, and a bit later, Stew Peters also did an interview about the story with a flat earther called Austin Wittsit, who said that germ theory is nonsense, but COVID-like symptoms might be explained by toxins in the mystery fog. In 2025 Latypova also started to claim that she and her husband got COVID-like symptoms after driving through a mystery fog. [pfizerstew.html#Latypova_got_COVID_from_fog]

Connections to Scientology

In 2006 Mike Adams wrote: "Want to learn more shocking facts about modern psychiatry? Visit the Citizens Commission on Human Rights. It's a grassroots organization that fights against the evils of psychiatry and Big Pharma. It was originally set up by the Church of Scientology. I'm not a member of the church, but on this issue I agree with them completely: Psychiatry has gone mad, and it must be stopped." [https://www.naturalnews.com/counterthink/Modern-Psychiatry.html]

Mike Adams did a documentary video for CCHR titled "Psychiatry in the Military", which at one point was the featured video on CCHR's YouTube channel. [https://www.youtube.com/watch?v=sHC2wH_iGYM] Mike Adams has also won the CCHR Human Rights Award, and his articles have been republished on CCHR's website. [https://www.cchrint.org/2011/09/07/naturalnews-names-award-winner-for-2011-jim-marrs/]

In 2007 Mike Adams published an article about the history of tyranny by the FDA, where he wrote that the FDA tried to unfairly regulate the use of E-meters: "In the early 1960s, the FDA got word of something it didn't like: The Church of Scientology was helping its members overcome mental problems with the use of a simple biofeedback device called the E-meter. With the market for psychotropic drugs so consistently profitable, and with Scientology gaining momentum in helping millions of people overcome severe emotional and mental problems, this E-meter had to be taken out of play... and fast!" [https://www.naturalnews.com/021791.html]

In 2010 Natural News linked to a Breitbart article titled "Scientologists use therapeutic touch to help Haiti victims", which said that a victim of the Haiti earthquake didn't have to get his leg amputated because his leg was touched by a Scientologist energy healer. [https://www.naturalnews.com/headlinesnews.html, http://web.archive.org/web/20100126072821/http://www.breitbart.com/article.php?id=CNG.4e601264cbdad356a9d677659aa5919c.51&show_article=1]

People connected to Greg Harrison or Solution of Scientists

Wayne Crouch

Wayne Crouch is the "head reporter" at Australian National Review, which looks like an Aussie version of the Stew Peters Network. He also has his own SPN-style media operation called Pure Media Australia, which gets very little views for their videos, even though he has managed to score interviews with many big names in alt media.

The Rumble channel of Pure Media Australia features interviews of these people: [https://rumble.com/c/puremediaaustralia/about]


After every article on the website of Pure Media Australia, there's this meme-style image that features Shankara Chetty: [https://puremediaaustralia.org/f/global-conspiracy-exposed-unveiling-the-ultimate-bioweapon]

Shankara Chetty is the sidekick of Philip McMillan, but McMillan promoted An Unholy Triad and Greg's ORFs hoax. Chetty says that long COVID is caused by gut bacteria that have been programmed to produce snake venom. Chetty was featured in Watch the Water 2, where Bryan Ardis said he had been on Zoom calls with Chetty for three years. Chetty also said that one of his guardian angels was the counterterrorism expert Tau Braun, and that Tau told him to keep an eye on snake venom, and that he and Tau were snake venom merchants. Tau Braun says that the calamari clots are made of tissue that was programmed to grow venom glands by nanobots that employed graphene oxide as the delivery mechanism.


The Twitter user Sudden and Unexpected posted a TikTok video where some guy called Randall Burton said: "See, back in early 2013, I participated in mRNA-based immunomodulatory medication trial. So, yeah, a medical trial on an mRNA-based medication that was meant to alter how the T-cells produced antibodies. And it worked phenomenally for not just lupus, but also for colitis, Crohn's disease, multiple sclerosis as well. Here's the kicker. Out of that trial, there were over 200,000 participants. And every last one of us, including myself, had their heart stop. There's less than five of us that are still alive today, but all of us experienced our heart stopping at least once. According to my doctor, less than five of us are still alive." [https://x.com/toobaffled/status/1911863358619525234]

Then Wayne Crouch replied: "This is my mate, his name is Randell and yes this is what happened to him he has been gutted like a fish almost and tossed back together, he was lucky to have survived the ordeal and likely the only victim that actually is left alive talking. I know the full details as to who did what to him or as full as he could give to me and I can tell you right now he is not a liar, even after all the threats and back lash he still tries to save people from going through what he has half the attacks are likely paid for by big pharma the rest are so bloody wrong and out of touch with reality it just ain't funny." [https://x.com/WayneC50256258/status/1911971108947153391]

When I searched Twitter for Randall Burton mrna, there were only three results, which all linked to a video on Wayne Crouch's Rumble channel:

Randall Burton's video was retweeted by Phillip Triantos, who was featured in Maria Zeee's clot panel together with Crouch:


Wayne Crouch said that in order to prevent him from telling the truth, he has had black helicopters in his yard and cars trying to run him off the road: [https://x.com/WayneC50256258/status/1950832585887666482]


Here Wayne Crouch said that amyloid clots are causing humans to go extinct: [https://x.com/WayneC50256258/status/1953587190199652579]


The majority of recent articles at ANR appear to be copied from Epoch Times, but ANR has also published many articles copied from Natural News. [https://eyesoftherepublic.com/2024/07/09/russian-disinformation-ecosystem-chart-featuring-global-research-natural-news-and-others/] Greg Harrison supposedly set out on his quest to do an ICP analysis of the clots after he saw the ICP analysis of Mike Adams published by Epoch Times.

Daniel Santiago

I'm not sure if Daniel Santiago is a member of Solution of Scientists, but he was listed in the credits of the Unholy Triad videos, and he was featured in Maria Zeee's clot panel together with Hirschman, Greg Harrison, and Wayne Crouch.

The only scientific paper about the calamari clots I have found is a paper by Daniel Santiago and John Oller that was published in IJVTPR in 2023 (if I employ a very loose definition of a scientific paper that includes pseudo-scientific papers masquerading as scientific papers). [https://ijvtpr.com/index.php/IJVTPR/article/view/73] John Oller is the editor-in-chief of IJVTPR, and Daniel Santiago is a member of the editorial board of the journal. A common pattern with the papers published in IJVTPR is that one or more of the authors are members of the editorial board.

The paper by Santiago and Oller is titled "Abnormal Clots and All-Cause Mortality During the Pandemic Experiment: Five Doses of COVID-19 Vaccine Are Evidently Lethal to Nearly All Medicare Participants". The paper has a long introductory section that talks about the clots, even though the results section describes an analysis of mortality statistics that doesn't have anything to do with the clots.

As a sample of the content of the paper, the following is how Santiago and Oller proved through combinatory logic that vaccines kill people, generalizing from proofs by the mathematician Gregory Chaitin:

In the instance of the synthetic XNA coding for the SARS-CoV-2 spike protein, every instance introduced in, say, the Pfizer BNT162b2 injectable, is supposed to consist of an exact replica of a string of pseudo-codons pretending to be ordinary self-produced mRNA authored by the body's native nuclear DNA. In that respect each one of them is a lie to begin with. The SARS-CoV-2 virus itself, pretending to belong inside the cells, tissues, and organ systems of any human body is already a lie before it is transformed into any genetically modified XNA. However, when it is transformed into its XNA shape, coding for the 1273 amino acids of just the SARS-CoV-2 spike protein, it is modified to contain many additional lies embedded within itself. By simple combinatory logic we can show why those lies, billions of them in each dose of every genetically engineered injectable (Pfizer 13.1 billion, Moderna 13.1 billion, AstraZeneca 50 billion; according to Fleming, 2021, p. 99), must tend to increase exponentially over time into a multitude of multitudes of lies that rapidly reach a level of irreducible complexity (generalizing from proofs by Gregory Chaitin, 2004, 2007). Unless all of those lies can be expunged, corrected, or at least quarantined and ignored by the body's biosignaling systems, they must lead toward disorders, diseases, and the eventual catastrophic breakdown of the body's biosignaling systems which is death.

Apart from Daniel Santiago and John Oller, other members of the editorial board of IJVTPR include Daniel Broudy and Shimon Yanowitz. [https://ijvtpr.com/index.php/IJVTPR/about/editorialTeam] In 2022 Yanowitz told Sasha Latypova that when he looked at his blood under a microscope, he found a synthetic fiber that may have been a Morgellons fiber, and he said it looked very mean and that made red blood cells nervous. He also said that he found strange objects in his blood that looked like dinosaurs and missiles. Yanowitz also said that he and Latypova were mutual friends with Wayne from Australia, which probably referred to Wayne Crouch. [https://www.bitchute.com/video/9ZFHWKEYxlCa/, 36:42] Yanowitz probably referred to Youngmi Lee when he told Latypova that "you and I have a mutual friend in South Korea, who has isolated structures from blood of jabbed people". [41:54] Yanowitz, Broudy, Latypova, and Lee were all members of the IIRT nanobot research group.

IJVTPR is the journal that published the infamous nanobot paper by Daniel Broudy and Youngmi Lee in 2024. [pfizerstew.html#Paper_about_nanotechnology_in_COVID_vaccines_by_Young_Mi_Lee_and_Daniel_Broudy] IJVTPR has published three other papers about nanotechnology in COVID vaccines by Daniel Broudy, David Hughes, and Valerie Kyrie, who all have a background in psychology or propaganda research, and who all write for a website called Propaganda in Focus. Valerie Kyrie's bio says that she works "in the areas of political psychology, the psychology of atrocity, and psychological operations / perception management" and that "her doctorate in psychology focused on the topic of reality-perception and its manipulation". [https://ijvtpr.com/index.php/IJVTPR/article/view/49] Daniel Broudy is a former military intelligence agent who has a doctorate degree in applied psycholinguistics, and his bio says: "My work integrates research in linguistics, psychology, and communication theory to describe ways in which power centers design and conduct propaganda campaigns." [https://www.researchgate.net/profile/Daniel-Broudy] The bio of David Hughes says that he lectures in security studies and that his areas of research include psychological warfare and the "class relations behind psychological operations". [https://propagandainfocus.com/our-team/]

IJVTPR published a paper by Daniel Broudy and Valerie Kyrie, who wrote: "The impetus for this cross-disciplinary study was current reports from a substantial proportion of injected subjects who emitted alphanumeric signals in the frequency range corresponding to Bluetooth communications networks." They also wrote: "The 'vaccines' (hereafter, 'platforms') are at the very center of the construction of a global network of communications needed for the commodification of objects and bodies (Sinclair et al., 2019)." [https://ijvtpr.com/index.php/IJVTPR/article/view/49/302]

In 2022 IJVTPR published a paper by David Hughes, where he compiled microscope images published by various researchers who suggested that vaccines contained microchips, hydras, Morgellons fibers, nanoantennas, motherboards, graphene oxide razor blades, carbon nanotubes, nano-octopuses, mesospores, SIM cards, Trypanosoma cruzi parasites, hydrogel, microbubbles, long stick-like organisms, parasites attached to magnets, eggs that were hatching new structures, geometric structures that lit up when a mobile phone was used nearby, dark crystals, microelectric circuitry, and so on, and he wrote that the researchers must be onto something because "at least 26 different investigations of the 'vaccine' contents (almost entirely unrelated to one another) from 16 different countries on five continents converge on remarkably similar findings". [https://ijvtpr.com/index.php/IJVTPR/article/view/52/288]

A few days after IJVTPR published the paper by David Hughes, they published a response to the paper by Daniel Santiago. [https://ijvtpr.com/index.php/IJVTPR/article/view/56] Santiago had little negative to say about the paper, and he didn't question if the vaccines really contained structures like hydras or motherboards. But instead Santiago just said that vaccines didn't contain nitrogen or phosphorous, which he presented as evidence that vaccines didn't contain DNA or RNA but instead they contained "XNA" or "xeno nucleic acids", and he wrote that vaccines contained "intentionally manufactured self-assembling components, built mainly from carbon-based materials used in computing and super-conductors":

What is missing from the spectral analyses of the foreign elements in the main COVID-19 vaccines, Pfizer and Moderna for certain, and probably also missing from the other experimental products being widely distributed that are known to contain foreign aggregates of strange materials similar to those found in the Moderna and Pfizer injections, are the elements nitrogen and phosphorous. This is revealing because all natural DNA, RNA, and their protein products contain those missing elements. Nitrogen for protein synthesis and phosphorus for DNA, RNA, and energy transfer. Therefore, their absence from the foreign structures seen under many different microscopes in all of the COVID-19 so-called "vaccines" that have been examined, and also found in blood samples of persons injected with the Moderna and Pfizer concoctions, proves that these intentionally manufactured self-assembling components, built mainly from carbon-based materials used in computing and super-conductors, are connected with the avant-guard evolutionary theory and experimentation with what is known as XNA, Xeno (Greek for "foreign"), Nucleic Acid. Most of the relevant information is behind significant paywalls in esoteric journals specializing in this peculiar branch of highly theoretical and experimental chemistry.

Daniel Santiago has 8 works listed at Orcid, but 6 of them were published by IJVTPR and the remaining 2 works are preprints. [https://orcid.org/0000-0001-5975-0592]

In 2024 when IJVTPR published a paper about how there were supposedly "55 undeclared chemical elements" in COVID vaccines, a response to a critique of the paper was published by editors of IJVTPR, who included Daniel Santiago, Daniel Broudy, and Shimon Yanowitz. The editors wrote: [https://mail.ijvtpr.com/index.php/IJVTPR/article/view/114]

The COVID-19 injectables contain at least 55 undeclared chemical elements including so-called "rare earth" metals and 12 of the 15 lanthanides. The likelihood that such elements are not involved in self-assembling entities in the fluids and in the unnatural clots in many recipients is zero. Ongoing gain-of-function bioweapons research together with published agendas for population reduction and control suggest that military-grade nanotechnologies are at play in the world-wide COVID-19 experiment.

IJVTPR has now deleted the paper about the "55 undeclared chemical elements", but I found the paper mirrored on another website. [https://rdi.uncoma.edu.ar/bitstream/handle/uncomaid/18277/21102024%2BDiblasi%2Bet%2Bal_ICP-MS_05092024.pdf] The authors of the paper wrote that their vaccine samples contained a high amount of lanthanides, which are elements with an atomic number in the range of 57 to 70, and the authors presented it as evidence that vaccines contain nanotechnology: "Because the lanthanides, as we have noted above, are known to be extremely cytotoxic (Voncken, 2016; Balaram, 2019), their being discovered in significant quantity, and across the whole array of vaccines we have studies here, is suggestive of some kind of nanotechnological experimentation along the lines being discussed by Kyrie & Broudy (2022), Lee and Broudy (2024a), Hughes (2024), and others." (Where the papers by Kyrie, Broudy, and Hughes are all papers about nanobots published by IJVTPR.)

The paper about the 55 undeclared chemical elements was so fake that even Mike Adams said it was a hoax: "The study is a hoax. The ICP-MS instrument can't detect 'chemicals' in the first place. The reported numbers for many elements are far beyond the sensitivity capabilities of the instrument. The sample prep procedure is bizarre. The dilution calculations are wrong. The scary-sounding language of 'undeclared' elements isn't scientific or rooted in any regulatory requirements at all." [https://www.naturalnews.com/2024-10-16-the-chd-touted-science-paper-claiming-55-undeclared-chemical-elements-were-found-in-covid-vaccines-is-a-hoax-and-must-be-retracted-heres-why.html]


In 2025 Daniel Santiago posted the following list of his heroes who are fighting against the modern-day Nazis who have unleashed the killer clots on the world: [https://santiagod.substack.com/p/the-nuremberg-effect-rejecting-blind]

Voices Rising Against the Silence

Amid this ethical imperative, a cadre of courageous individuals has refused to remain silent, channeling the Nuremberg spirit by publicly documenting and analyzing these fibrous clots to expose potential cover-ups. Among them are:

One of the people on the list was David Nixon, who provided an AI-narrated audio file that was included in Santiago's blog post:

Andrew Zywiec

Andrew Zywiec was credited as a member of the "scientific research and advisory team" of the Unholy Triad videos. Wayne Crouch wrote "I personally know and work with @AndrewZywiecMD he is a member of our scientific research team". [https://x.com/WayneC50256258/status/1872576670034792737] Zywiec also posted images of Greg's HPLC results and wrote "this is my teams actual research in progress". [https://x.com/AndrewZywiecMD/status/1861089117779403240]

In 2024 the Twitter user Sense Receptor posted a video where Zywiec talked about Greg's fake HPLC results: [https://fixupx.com/SenseReceptor/status/1811847665573068883]

Zywiec's video was posted by a lot of accounts that promote Miles Guo, which are probably mostly bots, even though some of them might be manually ran accounts: [https://x.com/search?q=andrew+zywiec+clots+-andrewzywiecmd&f=live]


In February 2025 Zywiec told Joe Sansone: "There's some new information on open reading frames that I might get into on a - we can have a discussion about that offline or later." [https://rumble.com/v6piptl-dr.-andrew-zywiec-on-mind-matters-and-everythign-else-with-dr.-joseph-sanso.html?start=815] But I don't know if Zywiec has discussed Greg's ORFs elsewhere in more detail.


In June 2025 Zywiec tweeted: "I actually was one of the first doctors to work on these. Mass spec analysis, confirmed by two independent labs, show a remarkable pattern. No fibrin, abberant fibrinogen ratios of 9:4:1 a/b/y that should be 1:1:1, extremely high phosphorus, and other abnormalities." [https://x.com/AndrewZywiecMD/status/1929751981263851605] When someone told him he was misidentifying the clots, Zywiec replied "explain the absence of fibrin end product". I guess Zywiec didn't get the memo that HPLC only detects fragments of proteins, so it doesn't differentiate the fibrin polymer that consists of multiple fibrinogen units from fibrinogen, and it's normal for only fibrinogen but not fibrin to show up in the HPLC results.


In 2025 Andrew Zywiec was the first author of a paper about COVID vaccines, where the other authors were listed as Nicolas Hulscher, James Thorp, Irene Mavrakakis, Aaron Kheriaty, Marivic Villa, Edward Macie, Peter McCullough, Paul Marik, Charles Rixey, and Abraxas Hudson. [https://jpands.org/vol30no3/zywiec.pdf] It's interesting to see McCairn's sidekick Rixey connected to Zywiec:

Zywiec is also a military veteran like Rixey, because Zywiec served in the infantry in Iraq. [https://x.com/AndrewZywiecMD/status/1936603606209241389] One of the authors in Zywiec's paper was the Navy Lieutenant Ted Macie, who is the bald guy whose video about the DMED data went viral in 2023.

Here Zywiec expressed his support for Pete Chambers as a fellow veteran and whistleblower: [https://x.com/AndrewZywiecMD/status/1940625557064241426]


Jikkyleaks got blocked by Andrew Zywiec because of this tweet: [https://x.com/Jikkyleaks/status/1963041584691487181]


The following 5 videos were the earliest interviews of Zywiec I found in alt media, which include interviews by Pure Media Australia, Joe Sansone, and Vaxxchoice:

Date Interviewer Link
2023-02-16 Christopher James Dr. Andrew Zywiec Exposes Vax Genocide
2024-02-28 Wayne Crouch from Pure Media Australia PMA news speaks with one of the most censored Drs on earth Dr Andrew Michael Zywiec
2024-03-21 Bruce Scholl Call Them All Out! Says Rockstar Dr. Andrew Zywiec MD
2024-03-27 Joe Sansone Dr. Andrew Zywiec on Mind Matters and Everything Else with Dr. Joseph Sansone, EP 17
2024-03-27 Bill Lionberger from Vaxxchoice In the Lions Den - Spike Proteins Created by the MRNA

In June 2024 Andrew Zywiec and Daniel Santiago were interviewed by Bill Lionberger from Todd Callender's organization Vaxxchoice.

During the interview Zywiec talked about Santiago's nonsensical "quantum codon energetics" theory. He said: "Now, theoretically, though, when you look at the - when you look at the quantum energetics of bonding, these things should not be the same thing, right. So that's one of the things I said we won't get too deep into. Because this is actually an area of very high contention. So, because most people are going to say that genetically that's called a wobble base pair - that third base pair that changes - and you can change it and wind up with the same amino acid, but energetically it perhaps is not the same amino acid, when it comes down to the quantum physics." [https://rumble.com/v52qksk-in-the-lions-den-spike-proteins-created-by-the-mrna.html?start=1872]

At time 47:18, Andrew Zywiec said: "Now when you look at the actual structure of these clots though, they're not normal. Number one, they're not adhered to the vascular membrane, right, so you're not seeing them anchored to the von Villebrand, and anchored into the endothelial matrix." What he said seemingly contradicts the story of John O'Looney, who said that even though the bodies that were embalmed at his funeral home had likely been filled with calamari clots since 2021, he hadn't seen one of the clots until June 2022, because the clots were attached to the walls of blood vessels, so they didn't get pushed out along with the blood when the embalming fluid was inserted into the vessels.

Next Zywiec showed Greg's HPLC results and said: "But furthermore you expect the clots to be majorly formed of a protein called fibrin. Fibrin is the end of the coagulation cascade, essentially. Now, that's not happening. We have very little fibrin, almost none, right. We also have no thrombin, which is what creates fibrin, essentially, at an enzymatic level. We don't see any thrombin. What we do see is tons of fibrinogen, which is a precursor to fibrin. So that shows you that these are not - the coagulation cascade is not working properly. It's working very strangely."

However it's normal for HPLC results to include only fibrinogen but not fibrin. ChatGPT said: "HPLC results typically show fibrinogen but not fibrin because fibrinogen is a soluble plasma glycoprotein, whereas fibrin rapidly polymerizes into an insoluble network once thrombin cleaves off the fibrinopeptides. In chromatography, only soluble molecules enter the column and produce a measurable elution profile. Fibrin, once formed, undergoes self-assembly into large crosslinked fibers that precipitate out of solution and are therefore not recovered or detected under standard HPLC conditions. Furthermore, fibrin and fibrinogen share nearly identical amino acid sequences, differing only by the small fibrinopeptides removed during clot formation. These peptides are low in mass, hydrophilic, and often poorly retained on reversed-phase columns, so they are easily missed in analysis. As a result, HPLC runs predominantly reveal fibrinogen peaks, while fibrin either fails to enter the column in polymerized form or appears indistinguishable from fibrinogen if partially degraded."

Why didn't Greg or Zywiec or anyone else in their team figure out why fibrin was missing from the HPLC results? Greg claimed that the HPLC analysis was done by an unnamed PhD student who studied for a degree in protein chemistry. So the student should've also known why fibrin was not listed in the results. But I think it's likely that the PhD student doesn't exist, and Greg just generated fake HPLC data with AI, because I have busted Greg using AI to generate fake data many times, and he was not able to publish the raw data of his results, and he even refused to publish any detailed spreadsheet of his results. When I asked an AI to generate a fake table of HPLC results of a fibrin clot, my table looked similar to Greg's tables, and my table was also missing fibrin. But at first I didn't understand why my table was missing fibrin, so it seems plausible that Greg's crew similarly generated fake data with AI, but then they came up with the story that the missing fibrin was somehow anomalous, because they didn't know how to interpret the fake data they generated.

Theories about the nature of the clots

Composition of calamari clots according to different people

According to various people, the white fibrous clots contain the following material or structures:

The clots are like a mirror where people can see their pet topic, so Christie Laura Grace says the clots are caused by LNPs, Geoffrey Norman Pain says the clots are caused by endotoxin, Bryan Ardis says the clots are caused by snake venom, and Marc Girardot says the clots are explained by bolus theory.

Tau Braun said the clots are tissue that was programmed to grow snake venom glands by nanobots

In November 2022, Jane Ruby interviewed the counterterrorism expert Tau Braun, who said that COVID vaccines contain nanobots that employ graphene oxide as a delivery mechanism, and calamari clots consist of tissue that was programmed to grow snake venom glands by the nanobots: [https://rumble.com/v1ugjek-live-7pm-the-jabbed-are-growing-animal-venom-glands-and-ducts.html]

The description of the video said: "On today's Dr. Jane Ruby Show, Dr. Jane interviews Counter-bioterrorism expert Dr. Tau Braun who explains that self-replicating nanoparticles in the C19 shots are programmed to grow venom ducts inside the human body. His theory is that the jabbed are growing live venom gland cells and other animal structures. Dr. Jane shows you the DOJ's research using cone snail venom to make huge amounts of deadly synthetic conotoxins. They say that deep ocean cone snail venom is a serious threat to humans who never dive that deep!"

When Jane Ruby introduced Tau Braun, she said: "He has worked with many of the experts you have already seen on the Jane Ruby Show, like Sasha Latypova of Team Enigma, Bryan Ardis, and so many more." [8:50] Latypova said that hydrogel is probably incorporated into the calamari clots. [https://www.bitchute.com/video/6wSCNCHm1dUa/, 40:45] Bryan Ardis says that the clots are made of two snake venom peptides in hydrogel.

Tau Braun said that people were wondering if COVID vaccines contain snake venom or if they contain graphene oxide, but he said they contain both, because the graphene oxide acts as a delivery mechanism for the snake venom, and he said: "How do you get venom into the body and how do you keep it stable? You add graphene oxide." [13:18]

At time 40:33, Tau Braun said that the calamari clots consist of tissue that contains snake venom ducts: "Those monstrous clot-looking things are literally tissue that has grown a duct - and specialized ducts. The closest match I found to these fibrotic clots today is the chameleon tongue - it's the long, very very - extremely - it has what's called the tensile strength, it has elasticity to it. But it's extremely strong. Cause it has to whip out like a whip and it has to come back in, and so it has to have expansion at rapid speed, and it has to be able to go back. So it's like, elastic."

At time 17:40, Tau Braun said that if there is a species of snake that eats rodents, then the snake won't produce venom which affects amphibians but only venom which affects rodents, and in the same way the snake venom in the COVID vaccines was designed to not affect Aryans, because the COVID vaccines are a race-specific bioweapon that was created by the Fourth Reich: "So why are certain people totally fine from this? I'm gonna tell you that this was built by the Fourth Reich, and I'm gonna tell you that Aryans are not having a problem with this vaccine. I'm gonna tell you that you can stick this into an Aryan over and over. And what I mean by Aryan? I mean people that originally came from Viking heritage, Germanic heritage, and that basically you can go and look at those principles of what Nazis believe the superior race to be. And I'm gonna tell you this weapon was not built for them." Then Jane Ruby asked: "How do you know that? What evidence do you have to that effect?" Those are questions that hosts on alt media should ask their guests more often. But then as his evidence, Tau Braun said: "Well, we know that the spike protein affects chromosome 3, and we know it's a sequence of genes on chromosome 3 that relates to Neanderthal genes. Neanderthal is not Aryan. Neanderthal was a very specific tribe in Europe. They didn't move often. And over time, they basically - some people would say - interbread with what we call modern-day humans. I'd say the modern-day humans raped them. I wouldn't say that there was interbreeding at all, as harsh as that sounds. I'd say that this was a tribe that - their strength, their gain of function, if you want to call it as a tribe - was empathy. That's what the Neanderthal gene is really about. It is really about being a sentinel. It's really about being able to connect the dots. They were the first tribe on the planet that understood medicine. They took care of their elderly. It is everything that this pandemic is not, right?"

Elsewhere Tau Braun has said that Jews have a particularly high amount of Neanderthal ancestry: [https://www.facebook.com/drtaubraun/posts/pfbid02VdQ4eKRGZ73Snvsytep3b2e53uuzS7MUuZ25B7zVjFDzobGYoes8QQYZUwaDaA2Ll]

Tau Braun looks like a Middle Easterner, and he seems like a Jew based on his posts about Jews on social media, because for example he posted on Facebook about Egyptian Jewish traditions. [https://www.facebook.com/drtaubraun/posts/pfbid0HhNazBvJ26Xa4r8rR8FAh8P1MgB29gCqX5vHbYti9QNV64WYgxcT1YRgDhpKzJrel] Tau is a Hebrew name that is a variant of the name Tav. Jane Ruby is a convert to Judaism whose ex-husband Raymond Ruby is a Jew. [https://openvaet.substack.com/p/from-opioids-and-fraud-to-maga-and]

Tau Braun's bio says that he is a "U.S. National Counterterrorism & EMS Advisor and Trainer". [http://web.archive.org/web/20250122104451/https://www.drtaubraun.com/about] He has been a speaker at conferences like the "FEMA Active Shooter Preparation for Higher Education Workshop" and the "Homeland Security Advisory Council Crisis Leadership and Emergency Management Workshop":


When he was interviewed by Mike Adams in 2023, Tau Braun now had a new theory that the formation of the clots not only involves snake venom, nanobots, and graphene oxide, but that it additionally involves SV40. He said: "You've covered the big stuff on, the big thrombotic events, and the weird castings that are - that this thing can grow in the body - which I'm still trying to work out. I think it's a combination, of venom organoid cells, but I also think that there's something on the spike protein that's used in the vaccine called SV40 - Simian Virus, which is a polyoma virus. And people call that a promoter. I don't like it. It sounds like a, like somebody who promotes like a - a new product or a club. The actual word for things like SV40 is, they are called cell-penetrating peptides. And probably the most famous cell-penetrating peptide - or some of the proteins that are in sperm that are basically able to get through cell membrane, and then get their RNA or DNA to replicate inside, um, another cell. And that's how, um, the, you know, that's - that's why SV40 is in there as mRNA technology - to basically penetrate into a cell and then make more of itself." [https://www.bitchute.com/video/3PDYRFdS6te3, 38:59]

Tau Braun also said: "We talked about the amyloidic stuff, even before you get it - you got a chance to look at - at some of the, you know, tissue, the samples that you looked at - we, you and I - unpacked a lot of this, sort of the way we're doing it now." [20:20] I don't know if by "amyloidic stuff" he meant calamari clots, and if by the samples he meant the samples that Mike Adams got from Hirschman, but if both of those are true, then Tau Braun would've discussed the clots very early on with Mike Adams.


In 2025 Tau Braun tweeted: "Very interesting from this Covid Vaccine pusher. Put out two studies on UK jewish population and Covid but chose not to study or publish data on Ashkenazi being in a low risk category for severe covid and mortality." [https://x.com/drtaubraun/status/2003838042109296657] And he replied: "Sephardic jews are higher risk for severe covid and covid vaccine injury and death. Ashkenazi jews are low risk." So I don't know if he's saying that Sephardic Jews have particularly high Neanderthal ancestry but Ashkenazis are crypto-Aryans or something.

He also posted a list of "Spike Protein Pathology and Death Risk" by ethnic group, which said that Sephardic and Mizrahi Jews had a risk of 2.2, and Ashkenazis had a risk of 1.0, but he didn't provide any source for the list or explain how his numeric values were calculated. He said that his list showed "how efficiently the Spike Protein can hijack the three circuits (Hibernation-Torpor, Envenomation, Pregnancy Immune Tolerance)". [https://x.com/drtaubraun/status/1994868724608672162] He might have ancestry from Egyptian Mizrahi Jews, because he has posted about Egyptian Jewish traditions on Facebook and Twitter, and he looks less white than most Ashkenazis.


Apparently Tau Braun now says that McKernan's spidroin is somehow involved in the formation of the clots: [https://x.com/drtaubraun/status/2001067945292714014]


In 2026 Braun tweeted that creatives, empaths, and sentinels have now started to die in high numbers: [https://x.com/drtaubraun/status/2027794587343822893]


As another update from 2026, Tau Braun has now come up with a unique theory that SARS-CoV-2 does not exist as a virus, but it's still possible for components of SARS-CoV-2 to cause a pandemic in the form of transmissible prions from vaccines: [https://x.com/drtaubraun/status/2041915397511741502]

Justin Leslie said the clots are teslaphoresis carbon nanotubial systems

The most famous video by Project Veritas is probably the video where one of their undercover journalists went on a gay date with the mulatto Pfizer employee Jordon Walker. The undercover journalist was the Pfizer whistleblower Justin Leslie, who is also the person who is supposed to have provided the vaccine vials that contained hydras to Carrie Madej. [https://www.lifesitenews.com/news/documentary-indicates-james-okeefe-attended-bohemian-grove-suggests-hes-a-cia-asset] He also says that vaccines contain luciferace, which was one of the main revelations of Melissa McAtee, who is another former Pfizer employee who came out as a whistleblower on Project Veritas.

In April 2025 when Justin Leslie was a guest on InfoWars, he told Alex Jones that the white clots are teslaphoresis carbon nanotubial systems: "It's more just my perspective on the sense of what is the spike protein. It is some sort of toxic poison that is inside of the vaccine in the way that it was formulated. It is what was ultimately causing this teslaphoresis carbon nanotubial system to be created inside the body, which is ultimately what my hypothesis on the blood clots being pulled out of people are. And so, you know, ultimately, from my perspective, it's not even a lab leak, sir, it's a massive psychological operation." [https://rumble.com/v6spd0f-pfizer-whistleblower-justin-leslie-joins-alex-jones-to-reveal-how-mrna-covi.html?start=1267]

In another video, Leslie said that he was tasked by Project Veritas to do a story about the clots, but the story was never released. He said: "The first undercover investigation that I was part of was entitled 'Funeral Fun', and was with a seasoned undercover journalist, or UCJ, Crow, whose real name is Adam Sharp. We attended a conference in Tennessee with embalmers, morticians, and funeral directors. We were trying elicit these professionals on the blood clot samples that had been sent to us at PV." [https://rumble.com/v6wx5v8-project-whistleblower-chapter-9-funeral-fun.html?start=40] He showed these photos of clots, which I didn't find posted elsewhere on reverse image search engines:

It's interesting that Leslie happened to go to a conference of the Tennessee Funeral Directors Association, which is the same conference that Tom Haviland attended in 2025.

Bryan Ardis said the clots are made of snake venom hydrogel

In a video that Bryan Ardis did with Mike Adams in January 2023, Ardis said that the calamari clots are made up of two snake venom proteins: "There's this element in your blood called plasmin. It's designed to break down blood clots. When that happens, you get what's called elevated D-dimers. The elevated D-dimers - D-dimer is the production of, the degradation, the breakdown of blood clot - your body does. So as the body is trying to break down blood clots, you'll see this elevated D-dimer, which is what they said Charles Hoffe found in 60% of all of his mRNA injected patients in Canada, he saw elevated D-dimers. And imagine my shock to see that on Medscape.com, they write that every medical doctor should be looking for snake venom poisoning when you see elevated D-dimers. You should look for it. They're telling you, you should go look for. So I can actually answer everything about the blood clots with snake venom research publications right now, to both of you. And you, Mike, if you're getting a laser thing that can identify materials, it would help us identify these proteins that they are using to create fibrous blood clots from two proteins, from two different snake venoms. They know they can make it resistant to being breakdown. I can't believe it. It's insane." [https://rumble.com/v261tp4-must-watch-mike-adams-and-dr.-bryan-ardis-break-new-ground-clots-venom-and-.html?start=479]

Next Ardis pointed out how the blood clots of COVID patients were resistent to heparin, and showed a paper titled "Nanofibrous Snake Venom Hemostat", which said: "Patients on anticoagulant therapy such as heparin have diminished clotting potential and are at risk for hemorrhaging. Here we describe a self-assembling nanofibrous peptide hydrogel (termed SLac) that on its own can act as a physical barrier to blood loss. SLac was loaded with snake-venom derived Batroxobin (50 g/mL) yielding a drug-loaded hydrogel (SB50). SB50 was potentiated to enhance clotting even in the presence of heparin." [18:59] And he showed an image from the paper where snake venom hydrogel was applied to a cut to stop bleeding.

Next Ardis showed an article about a product for sealing wounds, which consisted of a hydrogel formulation that contained two proteins from snake venom, called ecarin and textilin. [https://www.smithsonianmag.com/smart-news/made-from-snake-venom-these-hydrogels-could-treat-uncontrolled-bleeding-180980295/] The article said that "The gel is also thermo-responsive, so it is in liquid form when stored in a cool place but will solidify at body temperature to seal the wound", which Ardis suggested might have explained why COVID vaccines had to be stored at a cold temperature.

Next Ardis said that glycerin might prevent the formation of clots induced by snake venom, and Mike Adams said: "And so, I mean, you really just nailed something huge here. I wasn't aware that licorice root glycericin could stop the binding of these venoms to the fibrinogen receptors. That is - that is huge." [34:35]

Then Ardis said that the blood of vaccinated people should be analyzed to see if ecarin and textilin can be isolated from the blood, because "If that's in the vaccinated people, they're injecting snake venom infused hydrogels to elicit blood clotting." [36:02]

Near the end of the interview, Mike Adams said: "I truly believe based on - on your research and what you've presented - I believe that the mRNA sequences contain, uh, venom peptide sequences as part of the overall picture." [44:35]


Ardis's theory that the clots are made of snake venom peptides in hydrogel is similar to a theory by Jessica Rose, who speculated that the calamari clots might be made of hydrogel formed by peptides akin to spider silk. She cited a paper where recombinant spidroin led to the formation of amyloid fibrils which then formed into a hydrogel, and she asked "Could it be that amyloidogenic peptides akin to spidroin are being translated in people and subsequently creating immobilizing hydrogel scaffolds for other proteins?" [https://jessicar.substack.com/p/what-a-tangled-web-we-may-have-weaved]

Precursors to the story about the calamari clots

Carrie Madej's hydra clots

In September 2021, Carrie Madej started to say that COVID vaccines contained eggs of a "transgenic parasite" of the species Hydra vulgaris. She also told Stew Peters that vaccinated people were growing hydra clots: [https://ambassadorlove.blog/2021/11/01/transgenic-hydras-parasites-a-biological-weapons-system-for-rapid-human-cloning/]

Carrie Madej told Stew: "Let's just look at these water parasites. These things have the potential to grow, and be innumerable, right. If you're growing things, it has the potential to clog your arteries, it can clog capillaries, it can clog lymphatics. So we see blood clotting happening, and plus the body's response to having an infection, or a parasitic invasion, right, would be an inflammatory response, would be to have inflammation, which perhaps clotting an area." [https://www.bitchute.com/video/CU7FTZwr54yP/, 12:12] And then the video cut off to the photo of the clot above, and Madej said: "So, they're pulling clots sometimes out too that's almost as big as my hand, you know, has finger-like extensions coming from let's say the heart."

However the hydra clot was actually a clot from the lungs of a heart failure patient from 2018: [https://empr.com/home/news/heart-failure-patient-coughs-up-bronchial-tree-shaped-blood-clot/]

I'm not sure if Carrie Madej is a Jew, but she said that her family members died in the Holocaust, and she said that she uses the Messianic Jewish Bible, and she posted a photo on Instagram which showed a page from the New Testament in the Complete Jewish Bible. [https://odysee.com/@TheZionistInspector/YouCut_20220808_061637448, https://www.instagram.com/p/CbSh525OyaT/] Richard Hirschman's cover photo on Facebook used to be a photo that displayed two Messianic Jewish books. [https://www.facebook.com/photo/?fbid=730445680433744&set=ecnf.100004049568699] I believe the first person who started to say that COVID vaccines were going to contain hydrogel was Celeste Solum, who was already making videos about "DARPA hydrogel" in March 2020, but she is also a Messianic Jew. [pfizerstew.html#Origins_of_the_story_that_COVID_vaccines_contain_DARPA_hydrogel] In Carrie Madej's first viral video in July 2020, she also claimed that COVID vaccines were going to contain "DARPA hydrogel", which would hijack the human body and enable people to be monitored remotely by AI. [https://www.bitchute.com/video/cfE4DcT62CO6/, 17:38] Carrie and Celeste were both connected to the Messianic Jews Steve Ben-Nun and Jana Sutoova, who were early people who promoted the story about hydrogel. [https://www.youtube.com/watch?v=zomnoTTlRy0&t=6m15s]

La Quinta Columna's black period blood with black clots

In 2021 before the story about a new type of white clots had been rolled out, La Quinta Columna did a video where they said that vaccinated women had black period blood that contained black clots (because graphene is black, and at the time La Quinta Columna were primarily famous for their claim that vaccines contained graphene oxide). A guy from La Quinta Columna said that a letter from their viewer said: "Dr. Sevillano, does the Moderna vaccine cause irregular periods and black bleeding clots? My 17-year-old daughter was given a dose of that poison, and now she's with bleeding out of the normal cycle, with black blood and black clots. It's been two months since she was vaccinated. Thank you, and go ahead. We are all La Quinta Columna. I know it." And then he answered that the symptoms were indeed caused by the vaccine: [https://www.bitchute.com/video/WGjJ2rgw14N9/]

In 2021 La Quinta Columna said that vaccinated parents had "pandemic babies" who had completely black eyes, and the babies were also developing rapidly, so that they were able to walk when they were 3 months old, or crawl when they were 2 weeks old: [https://www.orwell.city/2021/09/black-eyed-babies.html, https://rumble.com/vw4syd-la-quinta-columna-comments-on-new-video-of-a-black-eyed-baby.html]

In 2021 Bryan Ardis said that 2-year-olds were menstruating blood clots: "There's 2-year-olds who are already menstruating blood clots, few hours within their actual parents being vaccinated. This is already reported in 2-year-old, 4-year-old, 6-year-old daughters and girls. This is the attempt of those female bodies to remove the toxic effects they're being exposed to by their vaccinated parents, or whoever they're around." [https://www.bitchute.com/video/OpHAZhxeqddy/, 1:05:11]

Morticians in alt media before 2022

British funeral director Wesley

In 2021, Resistance GB did one interview with John O'Looney and another interview with a British funeral director named Wesley who seems to have later been forgotten:

Wesley said that around the time when people in younger age groups got vaccinated, he had about 2 to 3 times the normal number of funerals, and all of them were people aged 40 or younger (or possibly people in their 40s or younger). He also said there were no longer any elderly people dying because they had already died when vaccines were rolled out to older age groups. He said: "So this year, as the vaccinations have gone on, I've seen trends through the age groups. Obviously, it's not marked down that they're vaccinated. But to have the most funerals that you've ever done in two weeks, and they're all aged 30, 40, no older. [...] That's what I saw earlier in the year, when that age group got vaccinated. [...] Well you always usually deal with all different age groups, but as I was saying, the elderly that were probably gonna go in the next year - or year and a half or whatever - they've already gone. So, there's a big gap there. So we weren't having those deaths anymore. And, with younger people, they're now vaccinated, and I had about 12 in one go. [...] We normally have about 4 or 5 funerals going, not 12 - 11 or 12 - and not all of that age group. There would be old people in there. And then now it's quiet. And what I've seen is a lot of newborn babies in the fridges in the mortuaries." [https://odysee.com/@ResistanceGB/funeral-director-babies?start=76, transcript at https://dailytelegraph.co.nz/news/uk-funeral-director-there-are-10-times-more-dead-babies/]

It's not clear if he meant that all people who died were aged 40 but not older, or in their 40s but not older. And it's not clear if by all people he meant nearly all people, or literally all people. But in any case, his anecdotal statistics are completely unrealistic, and they are inconsistent with actual mortality statistics in England, where in May to June 2021 when the highest number of people in their 30s and 40s got vaccinated, only about 5% of all deaths were in ages 0-49: [https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/adhocs/1343dailydeathsbydateofoccurrence1stjune2014to31stmay2023bysingleyearofageengland]

t=setDT(readxl::read_excel("dailydeaths2014to2023england.xlsx",sheet=4,range="A6:CP3293"))
a=t[Year==2021&Month%in%5:6,.(age=0:90,dead=colSums(.SD)),.SDcols=4:94]
a[,sum(dead[age<50])/sum(dead)] # 0.05494073

At time 4:16 when Wesley was asked what causes of death he saw written down on the death certificates, he answered: "There's a lot of myocarditis, myocardial infarction - it's all blood, heart-based - pneumonia - but COVID, I've only had one this year. One COVID death written down since January." But according to Nomis, COVID was listed as the underlying cause in about 12% of all deaths in England in 2021: [https://www.nomisweb.co.uk/query/161.1/advanced.aspx]

A common trope among morticians in alt media is that they have a dramatic story to tell about dead babies, which is reminiscent of anti-German atrocity propaganda during World War I, atrocity propaganda about the Holocaust, and the story about babies in incubators in Iraq. But Wesley also said there were about ten times more babies dying than normally, so the fridges were packed full of dead babies. At time 2:57, the interviewer asked: "So, do you want to talk about the number of newborn babies that you've seen in the morgue?" Then Wesley said: "Oh, they're really high. They're up at about 13 in one hospital." Then the interviewer asked: "And how many would they usually have?" And Wesley replied: "They have fridges that will hold about 6 to 10 maximum. And they're never normally full. But now, they're on in the adult section." And the interviewer asked: "So, there's about maybe ten times the rate, wouldn't you say?" And Wesley replied: "Yeah. Yeah. And obviously they're either miscarried or full-term stillbirths, but not a lot's been said about it."

However based on this plot, the stillbirth rate in England and Wales was not particularly high in 2021: [https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/livebirths/bulletins/birthsummarytablesenglandandwales/2022]

Wesley didn't say anything about a new type of white clots during his interview. I only found one other video by Wesley, which was a short video from December 2021 where he said that the pandemic was fake, but he didn't mention seeing a new type of clots. [https://x.com/JournoJones05/status/1473397089128361988]

I found only a few tweets about Wesley. [https://x.com/search?q=funeral+director+wesley&f=live] In one tweet John O'Looney wrote "Meet Wesley and i have spoken to him to verify he is who he says he is, hes a good honest guy." [https://x.com/OlooneyJohn/status/1765146515662660003] Two other tweets were posted by accounts that promote Miles Guo: [https://x.com/wiGuWZf1EpnmDod/status/1457663137344212995, https://x.com/Paige56Japan/status/1457662661710082052]

Connection to DMED

Links between calamari clots and the DMED story

I have a theory that the story about the calamari clots might be a "sister psyop" of the story about the DMED data. The two stories were rolled out two days apart in January 2022, and they were presented by a similar cast of characters:

Daniel Horowitz

In order to find early tweets about the DMED data presented by Tom Renz, I used the query defense medical epidemiology database until:2022-1-30, but the earliest tweet I found was posted by Daniel Horowitz, who linked to an article where he interviewed Renz: [https://x.com/RMConservative/status/1486357637310603268]

Many other early tweets about the DMED data also linked to the article by Horowitz. (The article was deleted and it's not available at the Wayback Machine, but I found it copied here: https://catholiccitizens.org/views/98324/horowitz-whistleblowers-share-dod-medical-data-that-blows-vaccine-safety-debate-wide-open/.)

After Jane Ruby and Steve Kirsch, I believe Horowitz was the third person who interviewed Hirschman. During the interview, Horowitz told Hirschman: "You've done previous interviews with Steve Kirsch, Stew Peters, Jane Ruby. You know, again, Jane has said the craziest things on the shots, and every one of them turned out to be true." [https://podcasts.apple.com/us/podcast/are-the-vaccines-causing-solid-frankenstein-blood/id1065050908?i=1000551322493] I didn't find any interview that Hirschman did with Stew Peters before Horowitz, so I don't know if Horowitz mistakenly thought that Hirschman was included as a guest on an episode of Stew's show where Stew and Jane discussed the clots but Hirschman wasn't on the show.

But anyway, in April 2022 Horowitz also tweeted this video of clots from an unnamed embalmer, but I didn't find the video posted anywhere else earlier: [https://x.com/RMConservative/status/1519475175527526401]

In April 2022 Horowitz also tweeted this photo of a 17-inch clot that I didn't find posted elsewhere earlier: [https://x.com/RMConservative/status/1513673923174539264]

In July 2022 Daniel Horowitz posted the photo below on Gettr and wrote "These are clots that an Indiana embalmer pulled out of dead bodies recently." [https://gettr.com/post/p1hroyce14c] The photo may have come from Wallace Hooker who is from Indiana, but I believe in July 2022 Hooker had not yet appeared anywhere in alt media. I didn't find the photo posted anywhere else earlier:

Theresa Long

The DMED whistleblower Theresa Long is supposed to have discovered Richard Hirschman by chance and connected him with Jane Ruby. Hirschman said: "And then it happened that one of the whistleblowers - the DoD whistleblower, Dr. Theresa Long - just so happened to be attending a funeral service at one of the funeral homes that I do enbalming in. And they got on this topic after the service - her and one of the funeral directors - and the funeral directors says, 'I know somebody you need to talk to.' He put me in contact with her. I shared with her the images. And she was shocked because she was hearing things from soldiers that were having blood clots in their arms that were highly unusual. And so she ended up getting me in contact with Dr. Jane Ruby." [https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html?start=328]

In 2024 when Theresa Long was featured in a symposium hosted by Vaxxchoice, she told Jane Ruby that she was connected to Hirschman through a female nurse, which appears to contradict Hirschman's version of the story, where he was connected to Long through a male funeral director. Long said: "You know, one of my nurses - her father died of COVID. And she and I were both kinda quietly - I mean, she was quietly fighting, I was not so quietly fighting. But she came back to me, and she said, 'Hey, the coroner mentioned to me that they knew my dad wasn't vaccinated.' And she said - she asked, 'Why, how did you know that?' And they said, 'Well, we didn't have to pull any of these clots out.' And I said, 'What are - what are you talking about?' And she said, 'Yeah. Here's his number. I though you might want to talk to him.' So that is how that whole thing came about - and me meeting with Richard Hirschman - that just happened to occur because this nurse came to me." [https://x.com/RealDrJaneRuby/status/1944124945874706944, 2:23] I don't know if Long referred to Hirschman as a coroner by accident, because the word coroner is defined as "an official who investigates violent, sudden, or suspicious deaths". And in case Long meant an actual coroner, it's not clear how the coroner connected her with Hirschman.

In a video in 2025, Hirschman also said that he was connected to Long by a funeral director, and not by a nurse or a coroner: "And then it was in early January - or sometime in January - I ended up being put in contact with Lieutenant Colonel Theresa Long, and it was an interesting experience. By that time, I had at least a couple of dozen, if not more, photographs of these strange clots that I was seeing. She was a flight surgeon at Fort Rucker, Alabama, who was somehow connected to one of the funeral directors at one of the funeral homes that I worked for - put me in contact with her. What are the images? She was shocked. She then gave my information to Jane Ruby, Dr. Jane Ruby, who is where this story first went public in January of 2022." [https://rumble.com/v6z3xuw-documenting-genocide-the-vax-amyloid-clots-symposium.html?start=1771]

What makes Hirschman's chance meeting with Theresa Long even more suspicious is that Hirschman said that John O'Looney was one of his heroes, and that he first saw a video by O'Looney around September, October, or November of 2021. [https://rumble.com/vucdbi-embalmer-richard-hirschman-reveals-novel-clotting-in-65-of-cases.html?start=1850, https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html?start=227] But that would be before Hirschman is supposed to have come in contact with Theresa Long in January 2022. So the embalmer Long was connected to happened to be someone who was themselves watching videos in alt media.


In 2024 Jane Ruby wrote that she "developed" the story about the calamari clots over a period of six months with Theresa Long: [https://x.com/RealDrJaneRuby/status/1868712018028454008]

I don't understand how Long was involved in developing the story. Did she help coordinate the story behind the scenes? If Long's only contribution to the story was to connect Hirschman with Ruby, it would seem weird for Ruby say that Long was involved in "developing" the story.

In another tweet, Jane Ruby wrote that she "investigated" the story about the clots for months: "Stew Peters put out 'Died Suddenly' a pirated story of my worldwide exclusive story that I investigated for months, on the white embalmer clots". [https://x.com/RealDrJaneRuby/status/1861790568642203937] So by developing the story, she might have simply meant investigating the story as it developed. But considering how the clots are nearly certainly fake, perhaps Jane Ruby had some involvement in developing the script for the story, which would explain why she acts like she has ownership of the story. And Theresa Long worked on an Air Force base in Alabama, but Hirschman is an ex-military guy from Alabama, so it's possible that she served as some kind of a handler for Hirschman, or as an intermediary between Hirschman and Ruby.


In 2024 when Theresa Long was interviewed by Greg Hunter, Hunter said that he believes COVID vaccines change the DNA of vaccinated people. And then Long said: "I believe God's name is written on your DNA, the name of Yahweh. And Yahweh corresponds to the numbers 10-5-6-5, and that is the spacing of the base pairs in your DNA. And the 10th base pair, the 5th base pair, the 6th base pair, and then the 5th again, that's Yahweh." [https://rumble.com/v5hysr1-fact-covid-vax-kills-and-injures-according-to-lt.-col.-dr.-theresa-long-md.html?start=2642] Then Hunter said: "And this does change that sequence. This does change that code." And Long said: "There is there is more and more research showing that it does change your DNA. Yeah, that would be the basis for religious exemption."


In 2021 Callender was interviewed by some ex-military Qtard guy, who said: "I applaud Lieutenant Colonel Long and what she's doing. She also, she was, you know, biochemical weapon certified at Fort Detrick as well. So she has the ability to determine what is known as a bioweapon. And she comes out, I believe in her preliminary hearing, and even stated that this vaccine was eerily similar to a bioweapon in the sense of how it's designed." [https://rumble.com/volk7j-the-vaccine-is-a-bioweapon-lt-col.-long-synthetic-lifeforms-attorney-todd-c.html?start=1100] And then Callender said: "You're right, she was trained in chemical and biological warfare. And that was in fact her conclusion."

Her bio mentioned that she took a "Medical Management of Chemical and Biological Casualties course at USAMIIRD, Ft. Detrick", which is a single-week course meant for doctors and nurses, but it hardly gives her the ability to determine if COVID vaccines are bioweapons or not: [https://web.archive.org/web/20210929003149/https://americasfrontlinedoctors.org/2/wp-content/uploads/2021/09/AFFIDAVIT_OF_LTC2_Long.pdf, https://usamriid.health.mil/index.cfm/training/in-resident/mmcbc]

Her bio also says "7th Special Forces" without specifying what her role or activities were, and it's hidden in the middle of a list of courses she took, so I don't know if it means that she just took some single course at the 7th Special Forces Group. Or if the list is in chronological order and not in order of significance, there might be significant items hidden between insignificant items, like for example that she served in the 7th Special Forces Group while she took some of the courses she listed.

The 7th Special Forces Group is an airborne group that was originally stationed at Fort Bragg, but that was later moved to Eglin Air Force Base in Florida. It is "designed to deploy and execute nine doctrinal missions: unconventional warfare, foreign internal defense, direct action, counter-insurgency, special reconnaissance, counter-terrorism, information operations, counterproliferation of weapons of mass destruction, and security force assistance". [https://en.wikipedia.org/wiki/7th_Special_Forces_Group_%28United_States%29]

The undercover nurse Erin Olszewski said that she was "trained at the John F. Kennedy special warfare center in Fort Bragg in psychological operations and civil affairs". [https://gregwyatt.net/did-erin-malone-olszewski-work-undercover-at-hospitals-schools-and-orphanages-in-iraq/] Several people connected to the clots seem to be linked to the Air Force. Erin wrote that before she started her anti-vaccine organization in 2019, she worked in the antiterrorism units at MacDill Air Force Base in Tampa. [https://books.google.com/books?id=Dn_rDwAAQBAJ&pg=PT91] The headquarters of Special Operations Command are located at MacDill, and General Dynamics IT ran an anti-vaccine psyop campaign on Twitter out of MacDill. [https://www.reuters.com/investigates/special-report/usa-covid-propaganda/]

Todd Callender

Todd Callender is a military lawyer who worked with the DMED whistleblowers. He was listed in the credits of the Unholy Triad videos as having provided "legal advice and support".

Todd Callender first emerged in alt media in August 2021, when he did a talk at an event organized by AFLDS. [https://x.com/search?q=%22todd+callender%22+until%3A2021-9-1&f=live] During the talk, he said that Vaxxchoice was a sister organization of AFLDS. He told people to go to the website of Vaxxchoice, where they could fill a form to file a criminal complaint against a long list of defendants, who included Bill Gates, George Soros, and all directors of Pfizer and the WEF. [https://vaxxchoice.com/wp-content/uploads/2021/06/Combined-Criminal-Complaint-w-Instructions-for-Filing-1.pdf]

Soon after that Callender filed a lawsuit against the DoD to stop vaccine mandates in the military. [https://www.courtlistener.com/docket/60219585/robert-v-austin/] Jane Ruby provided an affidavit to the case where she wrote that Robert Young had found "visual microscopy evidence" that vaccines contained graphene oxide, "lethal parasites", and "stainless steel aggregations". [https://drjaneruby.com/dr-jane-ruby-affidavit/] Theresa Long provided an affidavit where she wrote that vaccines contained antifreeze, and she wrote "I cannot discern what form of alchemy Pfizer and the FDA have discovered that would make antifreeze into a healthful cure to the human body". [https://web.archive.org/web/20210929003149/https://americasfrontlinedoctors.org/2/wp-content/uploads/2021/09/AFFIDAVIT_OF_LTC2_Long.pdf] I didn't find any references to Theresa Long on Twitter that predated her affidavit to Callender.


In November 2023, Callender told Jane Ruby that calamari clots are 5G antennas: [https://rumble.com/v3yowh4-bombshell-proof-embalmer-clots-are-5g-controlled-human-antennas.html]

At time 13:10, Jane Ruby said this about the clots: "But the point of the story is, Mike Adams did an incredible analysis when he magnified at hundreds and hundreds and hundreds of times - he did see what looked like circuitry. We still don't know 100% what the chemical composition is, but we know that it was all metallic, and very rare metals that are not usually found in humans. So I want to put that together with our discussion, not to throw in just for the fun of it, but so that we can start to tie it together with what you have found." Then Callender said that he independently came to the same conclusion as Mike Adams, and the clots did in fact contain metals, and the metals acted as 5G antennas. And he said that ultimately the clots turned humans into cloud computing nodes that had interoperability with the 5G system.

Later at time 23:26, Todd Callender said: "And, so this has been further corroborated by Dr. Theresa Long. She's one of my affiants. You and her both have given expert testimony in my case where we asked - we filed it in the US Supreme Court, by the way, and - and what she came to observe after we started - you know, kind of drilling down on this - is that she noticed that a lot of the people on her post and other places had these weird rings on the top of their heads. And as we started to dig into this, the, the hackers were - or the paper about the hackers was saying - that because these people were being tracked too much - because the hackers were tracking too many people, it had a deleterious effect on people's bodies, as seen by, as indicated by the top of their heads, the GPS causing irritation." And Callender said: "It's the crown, the crown of the head is how she describes this. They brought us coronavirus. Corona is Spanish or Latin for crown. And so it makes perfect sense." And Jane Ruby asked: "And Dr. Long is seeing this in military patients that she's examining?" And Callender answered yes.

Often electomagnetic waves are visually depicted as concentric rings or arcs, like in symbols that depict Wi-Fi or cell towers, even though that doesn't mean that the intensity of the electromagnetic waves relative to the midpoint of the transmitting device would form rings that would have some stronger layers and some weaker layers.

And anyway, the way GPS works is that satellites transmit a GPS signal that is picked up by a passive receiver, so people are exposed to the signal from GPS satellites even if there's no GPS receiver inside their body to pick up the signal. And even if there was a GPS receiver inside the head, the part of the head directly above the receiver would not be exposed to additional radiation from the satellite.

In an interview with Lee Merritt, Todd Callender connected his 5G theory to Ryan Cole's theory that the clots are "amyloid", because Callender said that the clots are "amyloid antennas": "And I talked to the guy that was yanking these out of bodies, by the way, and others who tested them. And they're amyloid! And so, we went back and we figured out what is it, and they're actually the antenna part of our bodies that are hooked into the 5G network, bind to our wireless body area network. They're amyloid antennas! That's what they are! And as our body gets transformed into this synthetic version, you know, some blood flow goes past, some people surviving, some people don't." [https://rumble.com/v45696i-dr.-merritt-and-attorney-todd-calendar-on-the-enemy-within.html?start=2417] Then Lee Merritt asked: "So you don't think that's the hydra in that white stuff?" And Callender answered: "I think it's for sure. It's part of what we call amyloid. I'm not sure we really know exactly what it is. Well, it's okay. So amyloid could mean a lot of the - including scar tissue, as I understand it. But sure, absolutely. But sure, I think that hydras have actually been found. And those creatures, they're not regular biology either as I understand. They're effectively an alien species."

So Callender says that the clots are 5G amyloid antennas that contain hydras.


The Pfizer whistleblower Melissa McAtee works as a "program manager" at Vaxxchoice, and she is a regular cohost on Todd Callender's videos. [https://www.linkedin.com/in/melissa-mcatee-55a47630a/] When she first came out as a whistleblower on Project Veritas, her big revelations included that vaccines contained aborted fetal cells, luciferace, and graphene oxide. [https://www.projectveritas.com/news/pfizer-leaks-whistleblower-goes-on-record-reveals-internal-emails-from-chief] She also released photos that were supposed to show that vaccine vials contained a gel-like substance during the manufacturing process, which Sasha Latypova presented as evidence that vaccines contain DARPA hydrogel. [https://x.com/sasha_latypova/status/1706423055768260824, https://x.com/sasha_latypova/status/1662955987202973698, https://x.com/sasha_latypova/status/1686782269997113344]

The earliest tweet I found which said that dental anesthetic contained DARPA hydrogel referred to an interview of Todd Callender by Jane Ruby: [https://x.com/search?q=hydrogel+dental+until%3A2023-12-12&f=live]

The "Chief Analyst" at Callender's organization Vaxxchoice is Lisa McGee, who says that pharmaceuticals contain nanobots with IP addresses: [https://x.com/RealDrJaneRuby/status/1782592009963716914]

In one video, Callender said: "If you got the shots, the odds are according to US law that you are owned by the patent holders. You are a new species called Homo borgenesis, and you are owned. That's the nature of what our case says today." [https://x.com/RealDrJaneRuby/status/1793660043709341791]

In an interview in 2024, Callender said: "If you go to the NASA Langley research paper in 2001, you will find that they named our new species 'Borg'. It so happens there is a Borg particle in the shots and is well studied. It's well documented and it's verifiable. So what I'm saying to you might be a little bit more than what you want to hear, but it is nonetheless true." [https://robertyoho.substack.com/p/334-todd-callenders-version-of-the, 25:39] Then the interviewer said: "I don't think that because they named a particle Borg that it has any relevance towards turning us into cyborg warriors." But Callender replied: "No, no, no. Look, you missed the point. NASA Langley research paper, 2025 is what it talks about. Future of Warfare 2025, written in 2001. On the second page of this DoD guy that wrote it, he says we're going to name humans 'Borg'." The second page of the Powerpoint presentation consisted of a title for the following slides, which said "The 'Bots, 'Borgs,'& Humans Welcome You to 2025 A.D.". The apostrophe before the word "borgs" indicated that the word was short for "cyborgs", because some subsequent slides talked about cyborgs, but the presentation didn't say anything about how humans were going to be named "Borg". [https://dn721807.ca.archive.org/0/items/future-nasa/future%20nasa_text.pdf]


For a while episodes of John Davidson's Broken Truth show were copied on the Rumble channel of Vaxxchoice, which I think greatly increases the likelihood that Davidson is controlled opposition: [https://rumble.com/user/Vaxxchoice/livestreams?page=9]

John Davidson was featured as a cohost in a video by Vaxxchoice, where he said "I know Kevin McCairn personally. I find him to be a pretty trustworthy scientist, and the guy has a lot of integrity." [https://rumble.com/v6uatmr-truth-be-told-with-thomas-haviland.html] John Davidson has also appeared as a guest on McCairn's channel. [https://rumble.com/v54flba-charles-rixey-and-broken-truth-winning-information-warfare-doctrine-for-dis.html]


An old snapshot of Callender's website said: "IVERMECTIN has also shown to prevent prion disease from people who have had the Covid 19 experimental shots." [https://web.archive.org/web/20211128061154/https://www.vaxxchoice.com/] I believe the theory that the calamari clots are made of amyloid protein was originated by Ryan Cole, who lost his medical license for prescribing ivermectin when he worked as a telehealth doctor for AFLDS.

Pete Chambers and Sam Sigoloff

Apart from Theresa Long, the other two original DMED whistleblowers were Pete Chambers, and Sam Sigoloff.

During an interview with Wayne Crouch, Pete Chambers said: "So, being in Special Forces, in the Green Berets, is - our specialty's unconventional warfare, foreign and internal defense, direct action, weapons of mass destruction, those types of things. The biologic warfare falls in that category as well. Uh, but it puts me in - right in the front seat of uh, doing what we call, said, unconventional warfare, which - it has a heavy piece of psychological, psyops, or information operations, those kinds of things. So that's what uh - so they understand my background, it's just, I've done some of it for real, down the range, yeah." [https://rumble.com/v4uhu30-lt-colnel-dr-peter-chambers-warns-of-possible-future-biological-event%2e.html?start=135]

Pete Chambers has a show called Land of the Free, which is hosted by Todd Callender's organization Vaxxchoice. In one episode of the show, Pete Chambers interviewed Mike Flynn and Ivan Raiklin: [https://rumble.com/v6veqz3-the-state-of-the-nation-with-general-flynn-and-ivan-raiklin.html]

Sam Sigoloff started his podcast about a month before the DMED data was released. The first guests on his podcast were Jane Ruby, Sigoloff's wife, two people from a military podcast called Terminal CWO, Daniel Horowitz, and Bryan Ardis. [https://podcasts.apple.com/us/podcast/after-hours-with-dr-sigoloff/id1601073627] Ruby and Horowitz were two of the first three people in alt media who interviewed Hirschman, and Ardis was the star of a movie made by the people who made Died Suddenly. Soon after the DMED data was released, Jane Ruby dedicated an episode of her show to the DMED data, and she also appeared on Stew's show discussing the data.

Later guests on Sigoloff's podcast have included such renowned truthtellers as Lee Merritt, Ana Mihalcea, Todd Callender, Sasha Latypova, Richard Hirschman, Ivan Raiklin, and the flat earther David Weiss. Sigoloff has also interviewed a lot of military and special forces people. And after Maria Zeee and Stew Peters, Sigoloff was the third person in alt media I found who interviewed Tom Haviland.

When I searched BitChute for the oldest videos that matched Sam Sigoloff's name, the earliest video I found was an interview he did with Alec Zeck, who is an ex-military no-virus guy. [https://www.bitchute.com/search?query=sam+sigoloff&sort=old]

Tweets about clots by bots or accounts that appear inauthentic

Coverage of clots on fake news sites in April 2025

In April 2025, articles about the clots based on a Substack post by Haviland were published by several fake news sites, including Expose News, The People's Voice, Slay News, and Natural News. [https://expose-news.com/2025/04/03/fibrous-rubbery-clots-caused-by-covid-injections/, https://thepeoplesvoice.tv/embalmers-uncover-rubbery-clots-in-27-of-mrna-vaccinated-corpses-worldwide-over-past-year/, https://slaynews.com/news/embalmers-issue-chilling-warning-fibrous-clots-found-27-covid-vaxxed-corpses/, https://naturalnews.com/2025-04-06-vaccine-clots-exhibit-prion-like-seeding-activity.html]

The article by Expose News was promoted by the junk amplifier account toobaffled: [https://x.com/toobaffled/status/1907928501862490225]

Around the same time, Sense Receptor posted a video of Greg Harrison and Jim Ferguson posted a video of Tom Haviland: [https://x.com/SenseReceptor/status/1909741957942771987, https://x.com/JimFergusonUK/status/1909894887287185618]

Sense Receptor, Jim Ferguson, and toobaffled all post the same type of video clips from controlled alt media, and they all promote fake news sites like The People's Voice, Slay News, and Expose News. All three accounts are also promoted by the same type of bots.

In 2024 I scraped the reposts of about 80 accounts that I suspected to be bots that promoted content about COVID from the controlled alt media. When I sorted the accounts by the number of reposts by the suspected bots divided by the number of followers, and I excluded accounts that were not related to COVID and accounts with less than 10,000 followers, Sense Receptor ranked 5th highest, toobaffled ranked 7th highest, and Jim Ferguson ranked 15th highest: [bot2.html#Reposts_by_bots_compared_to_number_of_followers]

reposts followers     ratio            user comment
     69     19200 0.0035938    mariusknulst portrays a Norwegian lady but might not be a real person
     34     13000 0.0026154  McCulloughFund McCullough Foundation
    134     57400 0.0023345     sophiadahl1 another account of mariusknulst; promotes flat earth and Stew ops
    360    186700 0.0019282         MakisMD William Makis; was on TWC Canada's medical board
     41     21400 0.0019159   SenseReceptor news site run by Matthew Palleschi Hart
    627    363400 0.0017254 BGatesIsaPyscho Concerned Citizen; account with most community notes
    139     87100 0.0015959      toobaffled Sudden and Unexpected
     92     78100 0.0011780       _aussie17 former pharma executive; promoted Barry Young early
    483    482200 0.0010017 wideawake_media UK blog
    130    132700 0.0009797  CraigKellyPHON Australian politician
     22     26300 0.0008365   Stuckelberger Astrid Stuckelberger; pushes Stew ops like hydras
     35     41900 0.0008353    TheSeeker268 only reposted by one outlier account
    160    195700 0.0008176   newstart_2024 Camus; often reposted by Alex Jones
    351    439800 0.0007981 liz_churchill10 posts many video clips and does X spaces
    174    224000 0.0007768   JimFergusonUK UK politician who has a podcast focused on COVID
    104    136700 0.0007608          bambkb display name "Kevin - We the People"
    164    232000 0.0007069   CartlandDavid bio used to say his account was managed by a PR team
    125    180700 0.0006918    robinmonotti ran a Telegram channel with Mike Yeadon
     29     49100 0.0005906     COVIDSelect Subcommittee on the Coronavirus Pandemic
    374    694300 0.0005387    PeterSweden7 Peter Immanuelsen

If you scroll through the timelines of bots that promote content about COVID from the controlled alternative media, it's uncanny how the bots consistently repost a similar subset of accounts, but on the other hand there are many popular COVID-related accounts that are almost never reposted by the bots.

Twitter bots that have posted about calamari clots

In the previous section where I sorted accounts by the ratio of reposts by suspected bots relative to followers, the account mariusknulst ranked first and sophiadahl1 ranked third. They are both portrayed as accounts of the same Norwegian lady, but I suspect they are actually bots.

sophiadahl1 often retweets random tweets in languages like Turkish and Portuguese, which Norwegians are unlikely to understand:

When I scrolled through sophiadahl1's tweets, within 10 hours it had retweeted a tweet about flat earth, it had retweeted tweets in Turkish, German, Hindi, and Chinese, and it had retweeted accounts which quoted one of its tweets and commented on the tweet in Turkish, Bosnian, Finnish, Swedish, and Dutch:

The image below shows two variants of the same tweet that were posted by sophiadahl1 about one month apart. The tweets might have been generated by AI based on some template, where the AI humanized the text by introducing a certain number of errors to the template, so that the tweets don't look like grammatically perfect text that was generated by AI, but they look like text that was written by a crazy person. The red rectangles I added show that the older tweet included one error that was missing from the newer tweet, but the newer tweet included three errors that were missing from the older tweet, which wouldn't make sense if the new tweet was written by a human who edited the old tweet to fix errors: [https://x.com/sophiadahl1/status/1808009492262510961, https://x.com/sophiadahl1/status/1822181811012722858]

Later when sophiadahl1 posted a similar tweet yet again, there were more errors introduced to the tweet that were missing from both earlier versions, like that the word "fuellmich" was written in lowercase, and there were two superfluous spaces before punctuation characters. [https://x.com/sophiadahl1/status/1910948406752665726]

The sophiadahl1 account also promotes flat earth. Here it posted an identical tweet about flat earth that had earlier been posted by another account:

Here sophiadahl1 promoted a video about the clots by Peak Prosperity, but similar tweets had been posted earlier by accounts called JaneBond and Project TABS:

Here sophiadahl1 posted a tweet about the clots that had been earlier posted by JaneBond:

Below sophiadahl1 posted a video about calamari clots by Kla.TV, which is operated by a Swiss cult that is connected to Scientology. [turbo.html#KLA_tv_and_connection_of_Scientology_to_the_German_medical_freedom_movement] Similar tweets had been posted by JaneBond, and by Sudden and Unexpected which is reposted by the same kind of bots that repost sophiadahl1: [https://x.com/sophiadahl1/status/1846357133161316535]


I found a Vietnamese bot called Dungpikachu that mainly promotes a cryptocurrency called Pi. It often also promotes Elon Musk and Trump, and it also posts about Qanon. One time it quoted a tweet about calamari clots by a user called SmolfSmolf7, which is a similar Vietnamese bot that promotes the cryptocurrency Pi, Trump, Elon Musk, and Qanon: [https://x.com/Dungpikachu, https://x.com/SmolfSmolf7]


Twitter is full of bots that promote Miles Guo's movement and that post western conspiracy content in various languages. However it's not well known that there are also similar bots that promote the Raelian UFO cult and that promote the same type of conspiracy content. One of the bots is called NobbyRaelian, which posts in Japanese. It reposts a similar set of accounts that are reposted by other bots that promote content from controlled alt media, including BRICS News, illuminatibot, Concerned Citizen, Stew Peters, Mario Nawfal, Epoch Times, healthbot, Vigilant Fox, KanekoaTheGreat, Jim Ferguson, and Wide Awake Media:

NobbyRaelian posted this video of the reptilian nanowire that Mike Adams supposedly found in Hirschman's clots (which Mike Adams said had a surface texture that looked like reptilian scales): [https://x.com/NobbyRaelian/status/1908306733124247741]

NobbyRaelian has also posted many videos of Bryan Ardis, who was the star of Stew's previous hit movie before Died Suddenly:

NobbyRaelian also posted this video that promoted The Wellness Company's Spike Detox product:


Ellenng2013 is another account that looks like a bot and that has promoted the story about the calamari clots. It doesn't promote Miles Guo's movement even though it posts in Chinese, but it seems to otherwise operate in a similar manner as the accounts that promote Miles Guo. Ellenng2013 reposts the same type of users that are reposted by the Guo bots and Raelian bots, like for example Thekeksociety, bambkb, WideAwakeMedia, thehealthb0t, iluminatibot, ShadowOfEzra, KanekoaTheGreat, BGatesIsaPsycho, and redpillb0t:

Ellenng2013 also promotes flat earth:

And it posted this video where Tom Haviland showed a vial of calamari clots:

Ellenng2013 also promoted TWC's Spike Detox product:


The leader of the Raelian UFO cult is known as Maitreya Rael. His Twitter account only posts links and retweets, so it might be either a bot or a human-bot hybrid. It also retweets a similar set of accounts that are retweeted by bots, like Concerned Citizen, illuminatibot, Mario Nawfal, healthbot, Peter Sweden, Anastasia Maria Loupis, Chuck Callesto, Vigilant Fox, Wide Awake Media, and Robin Monotti. Similar accounts are retweeted by other accounts that promote Raelianism but that are clearly bots. Maitreya Rael also retweeted videos of calamari clots that were posted by thehealthb0t and DiedSuddenly_: [bot2.html#Maitreya_Rael]

One time Maitreya Rael linked to an article by Vigilant News in a tweet that said "Check up this awesome contentDr. Peter McCullough Gives Expert Testimony on the Safety and Efficacy of the COVID-19 Vaccines" (which unusually said "check up" instead of "check out", and the words "content" and "Dr." were joined together):

When I searched for tweets that matched the text "Check up this awesome contentDr.", I found bots that had posted links to several other articles about McCullough at Vigilant News. McCullough is TWC's chief scientific officer, and Vigilant News Network was founded by TWC's co-founder Foster Coulson: [https://x.com/search?q=%22check+up+this+awesome+contentdr.%22&f=live]

Tweet about Greg Harrison's analysis by a Chinese Qtard account

The tweet below says in Chinese: "Embalmer Richard Hirschman and other collaborating researchers (including retired organic chemist Dr. Greg Harrison) analyzed the composition of these blood clots. They found that these blood clots contained a class of abnormally folded starch-like proteins called prions". [https://x.com/m16tri/status/1911680094399316107] The tweet included an image by Kevin McCairn's resident meme artist UveBeenNudged:

The tweet was posted by an account that posts western MAGAboomer content in Chinese. I'm not sure if the account is a bot or not. Its banner image is an image of Elon Musk:

Many of the earliest tweets by the account were replies to Joe Biden that were written in English: [https://x.com/search?q=from%3Am16tri+until%3A2021-5-1&f=live]

The same account posted a lot about Q: [https://x.com/search?q=from%3Am16tri%20%23q&f=live]

The bio of the Chinese account has a link to a Rumble channel, which contains western MAGAboomer videos translated to Chinese. One of the videos features Carrie Madej and Lee Merritt, who both say there are hydras in COVID vaccines. And in another video Ryan Cole talks about calamari clots with Drew Pinsky, who is a member of the TWC's Chief Medical Board: [https://rumble.com/c/m16?page=5]

The Rumble channel also had a video about hydras by Carrie Madej, and a video where Greg Reese said that viruses are not real:

Chinese account that posted a video of Kevin McCairn

The junk amplifier account SenseReceptor posted a video of Kevin McCairn, which was quoted by an account that posts in Chinese called lex_is_lex_: [https://x.com/lex_is_lex_/status/1911825548373869052]

The most recent tweets of the Chinese account also included quote tweets of NicHulscher, _aussie17, vegastarr, iluminatibot, toobaffled, VigilantFox, liz_churchill10, P_McCulloughMD, redpillb0t, ShadowofEzra, DiedSuddenly_, BGatesIsaPyscho, and newstart_2024. They are all accounts that are promoted by the same type of bots that promote SenseReceptor.

Here lex_is_lex_ quoted a tweet about how Jane Ruby's chemtrail fog contained a Morgellons filament: [https://x.com/lex_is_lex_/status/1907591417758638446]

lex_is_lex_ also quoted a video by thehealthb0t about ball bearings self-assembling in castor oil. When I searched for the text of the tweet in double quotes, I found that a similar tweet had been posted by ProjectTabs (which I earlier found had posted a similar tweet about the calamari clots as the flat earther bot sophiadahl1):

When I scraped the timeline of lex_is_lex_ up to the point when the infinite scrolling stopped loading more tweets, these were the accounts with at least 5 total retweets or quote tweets:

53 toobaffled # Sudden and Unexpected
16 iluminatibot # bot linked to IlluminatiCoin cryptocurrency
16 NicHulscher # foundation administrator of McCullough Foundation
15 RedpillDrifter
15 BGatesIsaPyscho # Concerned Citizen (account with highest number of community notes)
13 maximumpain333
11 vegastarr # promotes junk conspiracies like flat earth and Tartaria
11 redpillb0t # bot linked to IlluminatiCoin cryptocurrency
11 Uncommonsince76
11 ShadowofEzra
10 lex_is_lex_
10 WallStreetApes
9  VanceE
9  SenseReceptor
9  DavidWolfe # flat earther health guru whose account is likely a bot or a human-bot hybrid
8  VictorFromDE
7  thehealthb0t # bot linked to IlluminatiCoin cryptocurrency
7  liz_churchill10
7  Mind_Essentials
7  Maddi0578PG
7  Lovandfear
6  DrSuzanneH7 # Suzanne Humphries
6  AmurakaHidden
5  theamuzed1
5  kevinnbass
5  _APWK_
5  RealDrJaneRuby
5  LucasGageX
5  HealthRanger
5  DiedSuddenly_

Added later: lex_is_lex_ posted this tweet about a nanobot that was half a millimeter wide: [https://x.com/lex_is_lex_/status/1939867655181050143]

Video by Robert Young posted by thehealthb0t

Dave Cartland is one of the people who are frequently reposted by bots that repost the IlluminatiCoin bots, along with people like Peter Sweden, Liz Churchill, Jim Ferguson, Craig Kelly, and William Makis.

Cartland's bio used to say "Managed account by PR team" for a while in 2024, but I don't know if he now runs the account himself: [https://xbase.so/CartlandDavid]

Here Dave Cartland quoted a tweet where thehealthb0t posted a video where Robert Young, who said that the clots contain graphene nanowires and nanosheets: [https://x.com/CartlandDavid/status/2040432518260769232]

Similar tweets have been earlier posted by many other bot accounts: [https://x.com/search?q=%22young+outlines+what+he+has+been+seeing+from+jabbed%22&f=live]

The account Ask-Jerry portrays a person from Ghana who for some reason posts about American MAGAboomer topics: [https://x.com/myResearch%5f]

Ask-Jerry was previously known as JA_strategist and ActivistJerry. I ran across into the account in 2024 because it promoted a video about nanobots by The People's Voice: [https://x.com/JA_strategist/status/1822367446835007495]

At the time it frequently also posted Elon Musk fan tweets:

Miscellaneous topics

People featured in the Died Suddenly movie

I found footage that looked like original video footage of the following people in the Died Suddenly movie, sorted by the time of the first appearance: [https://rumble.com/v21zezm-the-died-suddenly-documentary.html]

Time Person
6:11 Chad Whisnant (funeral director)
8:16 Richard Hirschman (embalmer)
10:30 anonymous male funeral director and embalmer from Washington
10:44 John O'Looney (UK funeral director)
11:26 Brenton Faithfull (New Zealand embalmer)
11:33 Anna Foster (embalmer)
13:15 Wallace Hooker (embalmer)
14:12 anonymous female Canadian embalmer (probably Laura Jeffery)
16:01 Nicky Rupright King (embalmer)
16:26 anonymous female who talked about embalming
20:52 Theresa Long (DMED whistleblower)
23:22 Pete Chambers (DMED whistleblower)
32:20 Ryan Cole
33:57 Steve Kirsch
37:48 unnamed family pediatrician

At time 14:12, there was a brief clip of an embalmer whose face was blurred, but she looked like Laura Jeffery. Her voice was pitched down, but she sounded like Jeffery when I adjusted the pitch. She said: "As a Canadian embalmer, I have found that everybody I embalmed for over a year had fibrinous mass clots. The fibrinous mass clots had been fed by blood clots at the ends that were integrated into the fibrinous mass clots. The fibrinous mass clots themselves were not blood clots. On average, I would embalm a body every day or two. Every single body had them and they were massive."

At time 16:26, an anonymous female with a southern US accent said: "I began noticing strange things with the blood, looking like it had coffee grinds or sand in it, to complete separation like a clear orange-ish fluid, and then clots. It's coming later like the blood had almost separated. And of course, then there are the fibrous structures that we get, and it doesn't matter if it's a young or old person." While she spoke, the film showed a photo of a tube that looked like it had one layer for plasma and another layer for red blood cells, as if blood fractionation was somehow a novel phenomenon that was caused by COVID vaccines. A similar photo of fractionated blood was also included in Burkhardt's final interview with The Last American Vagabond. [https://rumble.com/v42yfh5-pathologist-arne-burkhardt-final-interview-revealing-the-grave-dangers-of-m.html?start=6091]

Chad Whisnant was featured prominently in the Died Suddenly movie, but I found little information about him, and I didn't find any place he had appeared in alt media apart from the Died Suddenly movie. Whisnant and Nicky Rupright King are both people from Alabama who know Richard Hirschman.

The Died Suddenly movie featured about 7 minutes of footage of Steve Kirsch, which was the second most footage of any person after Hirschman, even though Kirsch didn't even talk about the clots in the movie. Kirsch is connected to the story about the clots in multiple ways, because I believe he was the second person after Jane Ruby who interviewed Hirschman, and the first person who interviewed Anna Foster and Cary Watkins, who to my knowledge were the next two people after Hirschman who said they had seen the clots. Jane Ruby wrote that Kirsch worked with Epoch Times to put out his own version of the story about the clots, but they left her evidence out of the story. [https://x.com/RealDrJaneRuby/status/1946233270355587511] The results of Haviland's first survey were published by Kirsch, and Haviland supposedly got the idea to do the survey after he was connected to Laura Kasner in Kirsch's Substack comments. Kirsch has also hosted two video roundtables about the clots, and his first roundtable featured two embalmers who I haven't seen appear elsewhere in alt media. And Kirsch promoted the Unholy Triad videos on Twitter. [https://x.com/stkirsch/status/1905489721654165629, https://x.com/stkirsch/status/1907637107239350612]

Ryan Cole is the earliest person I have found who is not a mortician but who claimed to have seen the calamari clots, but he was also one of the few people featured in Died Suddenly who were not morticians. Ryan Cole was the Medical Director of AFLDS, and he worked as a telehealth doctor for AFLDS handing out prescriptions for ivermectin and HCQ. Hirschman is supposed to have been connected to Jane Ruby by Theresa Long, who supposedly discovered Hirschman by chance, but a few months earlier Long and Ruby provided affidavits to a lawsuit by the AFLDS to stop vaccine mandates in the military.

Calamari clots mentioned by a doctor on mainstream TV in Thailand

I have found no-one on mainstream media who has claimed to have seen the calamari clots.

Aussie17 published a Substack post titled "Kaboom! Renowned Neurologist and Thai Red Cross Emerging Infectious Diseases Health Science Centre Lead Prof. Dr. Thiravat Hemachudha Exposes Vaccine-Linked White Clots on Thailand's Popular TV3". [https://www.aussie17.com/p/kaboom-renowned-neurologist-and-thai] So I thought maybe I have now finally found the first person on mainstream media who claims to have seen the clots.

However the Thai neurologist indicated that the source of his information was John Campbell's YouTube channel, and the neurologist didn't say that he or anyone he knows had personally seen the clots: