This page is an unfinished work in progress.
The table below is a complete list of people I could think of who claim to have seen the calamari clots in either dead or living people. I tried to link to the earliest source where each person made the claim, but in some cases I may have missed some earlier sources, and if for example a video was posted on multiple platforms, I didn't bother checking which platform the video was uploaded to earliest. I tried to find UTC dates when possible, but some dates are in an unknown timezone.
Location | Type | Occupation | Date | Interviewer or source | Name | Comment |
---|---|---|---|---|---|---|
USA, AL | dead | mortician | 2022-01-26 | Jane Ruby | Richard Hirschman | the earliest reference to a new type of white clots I have found |
USA, MO | dead | mortician | 2022-02-12 | Steve Kirsch | Anna Foster | possibly the second person after Hirschman who claimed they saw calamari clots |
USA, AL | dead | mortician | 2022-02-14 | Steve Kirsch | Cary Watkins | short audio interview of an embalmer who knew Hirschman |
unknown | dead | mortician | 2022-04-28 | Daniel Horowitz | anonymous | video of clots from an unnamed source (might have been Hirschman) |
unknown | living | ER doctor | 2022-06-13 | Mike Adams | anonymous | ER doctor interviewed by Mike Adams on InfoWars through voice changer |
unknown | dead | mortician | 2022-06-20 | Jane Ruby | anonymous | provided photos to Jane Ruby that looked similar to Hirschman's photos |
UK | dead | mortician | 2022-06-30 | Michael Gray Griffith | John O'Looney | had done videos for about a year before he first said he had seen calamari clots |
USA, IL | dead | mortician | 2022-07-03 | chansurance | anonymous | tweet about how daughter was an embalmer who had seen white rubbery clots |
USA, IN | dead | mortician | 2022-08-25 | possibly Telegram | Wallace Hooker | post copied by many accounts on Twitter and Telegram; original source unknown |
South Africa | living | naturopath | 2022-09-16 | Jane Ruby | Leunis van Rooyen | presented as a member of team of surgeons who had removed a calamari clot |
New Zealand | dead | mortician | 2022-09-26 | Matt Shelton | Brenton Faithfull | interviewed by NZDSOS cofounder who also claims to have seen the clots |
USA, AL | dead | mortician | 2022-11-21 | Died Suddenly | Nicky Rupright King | did embalming with Hirschman; only interview I found was with Jason Liosatos |
USA, AL | dead | mortician | 2022-11-21 | Died Suddenly | Chad Whisnat | little information available even though featured prominently in Died Suddenly |
unknown | dead | mortician | 2022-11-21 | Died Suddenly | anonymous male | featured only briefly in Died Suddenly |
unknown | dead | mortician | 2022-11-21 | Died Suddenly | anonymous female | featured only briefly in Died Suddenly |
USA | dead | mortician | 2023-02-04 | Pistol Packing Pilot | John (pseudonym) | sounded like Hirschman; same channel interviewed Hirschman 2 months earlier |
Canada | dead | mortician | 2023-04-01 | NCI Canada | Laura Jeffrey | said white clots resemble parasites that are feeding on jelly clots |
Canada | dead | mortician | 2023-09-30 | Epoch Times and NTD | Carolyn (pseudonym) | draft version of article was posted to Google Docs in 2022 |
USA | dead | mortician | 2024-02-08 | Steve Kirsch | Lorin Ware | featured in Kirsch's embalmer panel |
USA | dead | mortician | 2024-02-08 | Steve Kirsch | Bill | featured in Kirsch's embalmer panel |
USA | living | cath lab worker | 2024-02-25 | Philip McMillan | anonymous | cath lab whistleblower who is supposed to have contacted McMillan |
USA, FL | living | cath lab worker | 2024-04-03 | Tom Haviland | anonymous | cath lab whistleblower who is supposed to have contacted Tom Haviland |
USA, AL | living | radiologist | 2024-05-18 | Philip McMillan | Phillip Triantos | has done videos with Greg Harrison and Richard Hirschman |
USA, OH | dead | mortician | 2024-05-20 | Laura Kasner | anonymous | text-only testimony published by Tom Haviland's assistant |
unknown | living | surgeon | 2024-06-04 | John O'Looney | anonymous | endovascular surgeon who supplied photos and videos of clots to John O'Looney |
New Zealand | living | physician | 2024-09-14 | Philip McMillan | Matt Shelton | cofounder of NZDSOS; credited in An Unholy Triad |
New Zealand | dead | mortician | 2024-12-12 | NZDSOS | Diane (pseudonym) | text-only testimony published by NZDSOS on Twitter |
Jamaica | living | physician | 2025-02-20 | Philip McMillan | Azzard Comrie | Philip McMillan's high school friend from Jamaica |
Morticians like Hirschman have said that their colleagues have also seen the clots, but on the list above I did not include second-hand testimony that someone else had seen the clots unless the testimony of the person was the main topic of a video or a post, or unless for example the person is supposed to have released photos or videos of the clots. In the table above people with only second-hand testimony available are the anonymous embalmer whose video was posted by Daniel Horowitz in April 2022, the anonymous embalmer whose photos were shown by Jane Ruby in June 2022, the daughter of the Twitter user chansurance, and Tom Haviland's cath lab whistleblower. Some anonymous sources in my table might be duplicates of other sources in my table.
I only included people in my table who claim to have seen the clots in the body of a dead or living person, so my table is missing people who claim to have seen the clots when they analyzed the clots in a lab, who include Mike Adams, Ryan Cole, Ana Maria Mihalcea, Clifford Carnicom, Zandre Botha, Arne Burkhardt, Greg Harrison, and Kevin McCairn.
Tom Haviland has a jar of clots he shows during interviews, but I didn't include him on the list above because I don't know if he claims to have personally seen the clots in the body of a dead or living person. John O'Looney also has a jar of clots that he shows during interviews, so people who have interviewed O'Looney or Haviland in person might have also seen the jars, but I did not include those people on my list.
Arne Burkhardt is the only person I can think of who claims to have seen the clots but who does not come from an English-speaking country (even though I believe he didn't say he had seen the clots inside the body of a dead or living person).
In the table above 2 out of the first 3 people who claim to have seen the clots did their first interview with Steve Kirsch. I believe Kirsch also did Hirschman's second interview after Jane Ruby. And the Died Suddenly movie featured about 7 minutes of footage of Steve Kirsch, which was the second most footage out of any person after Richard Hirschman.
6 out of the last 8 people in the table above are all people who claim to have seen the clots in living people, but as far as I can tell, none of them said before 2024 they had seen the clots in living people. The only people I have found who had claimed before 2024 that they had seen the clots in a living person are an anonymous ER doctor who appeared on InfoWars and Leunis van Rooyen. Van Rooyen was presented by Jane Ruby as a member of a team of surgeons who had removed a calamari clot from the leg of a living person (but he also talked about snake venom and graphene oxide with Jane Ruby).
Richard Hirschman did his alt media debut on the Jane Ruby Show in January 2022. I haven't found any reference to a new type of white fibrous clots before his interview.
Jane Ruby brags that she broke the news about the clots, but she also brags that she was the first person to break La Quinta Columna's story about graphene oxide in English-language media: [https://x.com/RealDrJaneRuby/status/1619624953036558338, https://x.com/RealDrJaneRuby/status/1604355938881789952]
Hirschman wrote this about his clots in 2023: "If it wasn't for people like Dr Jane Ruby, Stew Peters, Mike Adams, Maria Zeee and several others, hardly anyone would know. Dr Jane Ruby was the first one to interview me and sharing this to the world." [https://x.com/r_hirschman/status/1690094446426157056]
When Hirschman appeared on the Jane Ruby Show, her show used to be part of the Stew Peters Network, which is notorious for promoting disinformation stories about strange objects found in vaccines or in the blood of vaccinated people, including hydras, microchips, nanobots, graphene oxide, snake venom, hydrogel, robot arms, shards of glass, neanderthal DNA, and gorilla feces. I call the stories "Stew ops", because the origin of the stories frequently goes back to the Stew Peters Network or to guests on their network. Stew Peters also says that the earth is flat and viruses are not real.
I believe the FEMA whistleblower Celeste Solum was the first person who started to say that COVID vaccines were going to contain hydrogel, but she has also said that COVID vaccines contain gorilla feces and Neanderthal DNA: [https://gettr.com/post/p2rc1em2ae7]
The director of the Died Suddenly film was Stew Peters, the producer was Lauren Witzke who at the time was Stew's producer, and the editor was Nicholas Stumphauzer who was hired by Witzke and Stew to do their movies. [http://web.archive.org/web/20221122001654/https://stewpeters.com/video/2022/11/live-world-premiere-died-suddenly/] Previously the same team produced a film called "Watch the Water", where Bryan Ardis claimed that COVID was caused by snake venom in tap water (which Stew's people said was a "truth satan himself has fought to suppress"): [http://web.archive.org/web/20221105032849/https://stewpeters.com/video/2022/04/world-premiere-watch-the-water/]
But anyway if the calamari clots are caused by COVID vaccines, then why was the story about the calamari clots only breaking news in January 2022? When I searched Twitter for embalmer clot until:2022-1-27
, I didn't find a single reference to the calamari clots that predated Hirschman's interview with Jane Ruby. [https://x.com/search?q=embalmer+clot+until%3A2022-1-27&f=live] I only found a few tweets which linked to an article from September 2021 titled "'The Clots Were The Size Of Pancakes' - Texas Embalmer Opens Up About Covid Horrors", but the article didn't discuss the new type of white clots that Hirschman is supposed to have found. [https://www.dailykos.com/stories/2021/9/13/2051954/–The-Clots-Were-The-Size-Of-Pancakes-Texas-Embalmer-Opens-Up-About-Covid-Horrors]
I also searched BitChute for the keywords "funeral director" and "embalmer" and I sorted the results by oldest first. There were several conspiracy videos posted in 2021 that featured morticians, but I didn't find any reference to a new type of white clots in the videos. [https://www.bitchute.com/search?query=funeral+director&sort=old]
I believe the first three people in alt media who interviewed Hirschman were Jane Ruby, Steve Kirsch, and Daniel Horowitz.
I think Kirsch was also the first person who interviewed Anna Foster and Cary Watkins, who to my knowledge were the next two people after Hirschman who said in public that they had seen a new type of white clots.
Daniel Horowitz also published early photos and videos of clots that I haven't seen published elsewhere earlier. [https://x.com/RMConservative/status/1519475175527526401, https://gettr.com/post/p1hroyce14c]
During an interview that Hirschman did with Australian National Review, he said that Wayne Crouch and Lisa Johnston from ANR were among the first people who interviewed him, even though their interview with Hirschman was published about 8 months after Jane Ruby's first interview with Hirschman. So I wanted to check how many other people interviewed Hirschman in between, but I was only able to find 4 other people, who were Steve Kirsch, Daniel Horowitz, Mike Adams, and Maria Zeee:
UTC date | Interviewer | Link |
---|---|---|
2022-01-26 | Jane Ruby | Worldwide Exclusive: Embalmers Find Veins & Arteries Filled with Never Before Seen Rubbery Clots |
2022-02-08 | Steve Kirsch | Embalmer Richard Hirschman reveals novel clotting in 65% of cases |
2022-02-16 | Daniel Horowitz | Are the Vaccines Causing Solid 'Frankenstein' Blood Clots? |
2022-05-11 | Jane Ruby | Voices From The Grave with More Embalmer's Mystery Clots |
2022-06-13 | Mike Adams on InfoWars | Mike Adams w/ mortician Richard Hirschman + Jane Ruby re fibrous clots in vaxxed |
2022-07-16 | Jane Ruby | White Clots Grow Mysterious Ball Sacks; America Is Flying The Deadly Skies; Spartacus Part 2 |
2022-07-19 | Maria Zeee | Richard Hirschman - WARNING: EXTREMELY GRAPHIC! Structures Killing Injected 1 Year After Shot |
2022-09-14 | Wayne Crouch and Lisa Johnston | Richard Hirschman speaks about the fibrous growths being found inside vaxxed |
In February 2022 Hirschman was interviewed by Daniel Horowitz, who I believe was the third person who interviewed Hirschman after Jane Ruby and Steve Kirsch. [https://podcasts.apple.com/us/podcast/are-the-vaccines-causing-solid-frankenstein-blood/id1065050908?i=1000551322493]
At time 36:13 Hirschman said: "John O'Looney is in the UK - he's not one of the three I'm referring to, but he's the first person - he's a funeral director that came out - and I saw a video of him last October or so. And what he described - what they're seeing over there, which he didn't put no pictures or anything - but his story of what he was seeing was almost identical to what I was seeing. And I did, you know, I did hear John O'Looney recently was asked about these kind of clots, and he said his embalmer has been struggling with this for several months now." However I believe O'Looney never said he saw the new type of white clots until late June 2022.
At time 44:26 Horowitz said: "You don't have any confirmed cases of seeing these crazy clots in someone that you know to be unvaccinated except for one case. Could you talk about that?" And then Hirschman answered: "Yes, there was a case that I - I was certain that this person was vaccinated by the way the blood looked. And that person wasn't and, - but then I found out, you know, that person had other medical issues, and so had received a blood transfusion." I think normally embalmers don't have access to the vaccination status or medical history of people they embalmed, so did Hirschman learn from a family member that the deceased person had received a blood transfusion? If he's a trade embalmer who travels from funeral home to funeral home, was he even present at the funeral home at the same time as the family of the deceased person, or did he just ask for their phone number from the funeral home or something? Or did people from the funeral home tell him about the blood transfusion, or did Hirschman ask people from the funeral home to ask the family members about the medical history?
Hirschman also didn't explain how he was able to tell if a person was vaccinated from the way the blood looked. Was he able to tell it with a naked eye or did he look at the blood under a microscope? Were there some other attributes of the blood besides the clots which showed him that a person was vaccinated?
At time 49:50 Hirschman said that James Thorpe told him: "You know, these big clots are alarming, but that doesn't scare him. What scares him the most are the microclots. The micro clots, the small tiny ones. Because he's afraid what happens with those small ones is they're going to end up finding their way to certain organs throughout your body and start restricting blood flow causing certain organ failures and other complications. So when when he told me that, I stopped and I said, 'Excuse me, doctor. Let me explain something - when I'm embalming a body, sometimes when I'm embalming and the blood is draining, it looks like - it almost looks like coffee grounds, little tiny specks of dark material coming out with the blood.' He said, 'That's what I'm talking about. Those are microclots. And those are dangerous because those can cause a heart attack and a stroke as well.'" But I think the microclots that Resia Pretorius and Douglas Kell have discussed are not visible with a naked eye, even though I don't know if it might be possible for microclots to accumulate into a clot that would be large enough to be seen with a naked eye. [https://pmc.ncbi.nlm.nih.gov/articles/PMC8381139/] But Pretorius and Kell said the microclots they described were caused by COVID, and "coffee ground" clots were already seen before COVID. I don't remember Hirschman having equated the coffee ground clots with microclots in his later interviews.
In June 2022 Richard Hirschman told Mike Adams: "Well I was asked earlier today by somebody who would like to speak to you, and he was asking if I could - you know, did I send samples of normal blood clots, and - to compare against normal blood clots. But I don't - I don't have anything like that. It seems like the clots have all changed. And I don't know what normal is anymore with the strange stuff that I'm seeing." [https://www.bitchute.com/video/Jw4nZtJXw5BK, time 28:21]
But it doesn't make sense that he no longer had any normal blood clots. Was he not even seeing normal blood clots in unvaccinated people? Laura Jeffrey claimed that the calamari clots were often attached to currant jelly clots so that the calamari clots seemed like they were feeding off the currant jelly clots, so doesn't that mean that at least some embalmers were still seeing the currant jelly clots?
In the 2023 embalmer survey, only about 4% of the respondents are supposed to have answered 0% to a question that asked "What percentage of the corpses in Year 2023 that you have embalmed have had traditional 'grape jelly' blood clots?" [https://www.skirsch.com/covid/EmbalmerSurvey2023.pdf]
During the same interview, Mike Adams asked Hirschman to send another sample of clots to him, and he said "By the way, just to honor the dead here. We are - you know, these people died, we believe from these clots. And I believe that if they could speak, they would want us to tell the world and sound out the alarm. And I don't want anyone out there to think, you know, that we are exploiting the tissues of these dead people for any kind of sensationalism." [15:18]
Even though that's exactly what Mike Adams did, when he claimed that the clots contained "nanowire interface structures", and the clots contained electric circuits which may have made it possible to track people in a similar fashion as RFID chips, or which would've made it possible to kill people remotely by 5G or DEWs, or which would've caused people to die if there was a solar flare.
Has Hirschman ever even said if he received consent from the families of the dead people to take samples from the dead bodies and send the samples all over the world? It seems like something embalmers wouldn't be allowed to do.
Brenton Faithfull said that he didn't have any photos or samples of the clots because embalmers were not permitted to photograph dead bodies or remove samples from the bodies (even though the practice in the United States might be different from New Zealand): "We've got to take into account the anonymity of of of patients. I don't have the authority to even photograph a deceased person, you know. The ethical dilemma that we face is as professionals - I think even permission to embalmer body is sought from a family - is in part of the contractual arrangements. And it's very loose, I think, most funeral homes have the same clause to perform any sanitary preservation in their judgment required, within the contract. Now that's a very loose term. Now, we don't have a license to practice anatomy, so technically we can't remove any samples. We're not allowed to." [https://rumble.com/v1odcne-new-zealand-funeral-director-brenton-faithfull-first-interview..html?start=1754]
I now listened to an interview that Hirschman did with Wayne Crouch and Lisa Johnston in September 2022. He said that Mike Adams had found that the clots were "some form of self-assembling material. Exactly what, you know, we don't know. He did find large amounts of tin in these clots. He found large amounts of aluminum and sodium - which he all - he says all of those are conductive elements. Which is kind of strange." [https://rumble.com/v1k1ijr-richard-hirschman-speaks-about-the-fibrous-growths-being-found-inside-vaxxe.html?start=1986] Then Wayne Crouch said: "Like you'll find in circuitry." Then Hirschman said: "Right." And Lisa Johnston said: "Not natural at all. Like not a natural occurrence." And Hirschman said: "Exactly. Now, people need to remember he has a lab - it's a credited lab, so you know, who am I to dispute what he has found. He's made it public. He's willing for everybody to look at it. If anybody wants to replicate this, they're welcome to do it. And that's how we get moving forward. So I'm glad he did it. It sounds science fiction to talk about, you know, ele-. These things that seem to be conductive in nature. That sounds really really hard to swallow. But great let's - let's somebody prove him wrong." Then Wayne Crouch said: "Well, he's always been right in the past. I mean, the guy really is a genius. And as you say, he has got one of the most amazing labs. Like he doesn't play games. When he puts out a story, he really researches the hell out of what he's about to-." [32:36] Then Hirschman said: "Mike Adams has got the lab analysis. It is what it is. I mean, he can't go in there and manipulate that. That stuff is dissolved, and it is - goes through that plasma machine or whatever it is that he has, and it reads the elements. It is - that's just what it is." [35:42]
So I guess in a way Hirschman expressed scepticism about Mike Adam's findings when he said they sounded like science fiction and they were difficult to swallow. But on the other hand he stated it as a fact that Mike Adams "can't go in there and manipulate" his lab results.
Richard Hirschman was interviewed by Ana Maria Mihalcea in February 2024. [https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html]
Mihalcea said that when she looked at Hirschman's sample of coffee ground clots under a microscope, "I saw that stuff was moving, and you see that these round little spheres are actually developing here. And if I speed this up, it is actually growing. And the spheres contain these little tiny blinking lights that I call quantum dot micro robots, which is the same stuff that we saw in the Pfizer vial." [32:09] And she said: "And these little blinking lights, there may be 500 nanometers or something like that. And they change colors from blue to yellow to red, which is exactly what quantum dot micro robots do. So this is technology for biosensing application." [33:36] And she said that when she looked at a sample of unvaccinated blood, it also contained the blinking lights, and it contained hydrogel that formed rubbery filaments, which she said was due to shedding. And she said: "And they are literally changing the red blood cells. They're sucking the blood dry, taking its energy, which in the nanotechnology literature - this is called energy harvesting for intra body area network. Nothing in the body is supposed to blink like this. So these are biosensors, and look at their swarming. This isn't natural, this is all technology basically, you know. And so what happens is if I just observe this stuff over a long period of time, you see that these bots literally eat up the red blood cells until nothing is left of them. This is literally forming the clot before my eyes." [35:19] And she said 30 minutes later the bots had harvested all the electricity and life force out of the blood cells, so only a skeleton of cells was remained, where the skeleton was connected by hydrogel polymer plastic rubber. Next she said: "The rubber stuff is made from these filaments that Clifford Cardicom calls cross-domain bacteria or Morgellons filaments. They grow out of those little round things and become larger." [38:04] And she said the rubber was what the rubbery clots were made out of.
After that Hirschman didn't have anything critical to say about Mihalcea's findings but he just moved on to the next topic. Later Hirschman said: "I had a live blood analysis of my own blood and I and my blood had some of those filaments in it too." [56:26] But it's not clear if by filaments he meant Morgellons filaments like Mihalcea.
At the end of the video Hirschman said: "I don't like the infighting and stuff like that between people that are on our side trying to get rid of the shots. Have compassion on those folks. Some people get all upset if you don't want to call it what they call it. They may call it amyloid, you may call it a hydrogel, you know, nanotechnology, all these different things. And you know I think we need to hopefully - hopefully we all will come together and realize - I mean you got some pretty daggum solid proof behind you when you're showing the actual images, you're showing the blinking lights. Look, people can replicate this if they want to. They can replicate it."
So Hirschman said that these microscope photos of blinking lights were "pretty daggum solid proof":
Hirschman did his interview with Mihalcea more than half a year after Mihalcea had published her analysis of Hirschman's clots, where she claimed that the clots contained Morgellons fibers and Morgellons bacteria. [http://web.archive.org/web/20230711070359/https://anamihalceamdphd.substack.com/p/blood-clot-analysis-from-living-and] If Hirschman was for real, wouldn't he have realized that Mihalcea was a fraud? Other people probably also told him about how Mihalcea's analysis was fake. So then why did he agree to do another interview with Mihalcea later on? And why did he say that the light microscope photos of quantum dots were "pretty daggum solid proof"?
During an interview in 2024 when O'Looney was asked when he first started seeing the new type of blood clots, he answered: "So, really, in 2021, about halfway through, we started seeing lots and lots of people who were passing away suddenly, who were a lot younger than those that we were used to." [https://www.youtube.com/watch?v=wwdRfbPrGIY&t=10s] And a bit later he said this about the calamari clots: "I've got a BIE-registered embalmer who works for me full time, who's done 22 years, and he's never seen them before, uh, 2021, no." And the interviewer said: "So some people have think they've seen some small ones in 2020, but that's not your experience: it's 2021 they started, midway through 2021." And then O'Looney answered: "Yes, 100%, yeah."
However I didn't find O'Looney mentioning the calamari clots anywhere in 2021. During an interview on September 30th 2021, the only time he mentioned blood clots was when he said: "Children will get cardio issues, inflammation of the heart. There will be blood clots and all the things I'm seeing as a funeral director. Now as a funeral director I'm seeing four main causes of death coming into me now. I'm seeing heart attack and stroke as a result of blood clot." [https://antijantepodden.com/.ajp_enep026.html, 24:59] But he didn't say anything about a new type of white rubbery clots. And also in a video that O'Looney did in December 2021, he said: "We used to see a blood clot very very rarely, but now I've seen more this year than I have in the previous 14." [https://www.bitchute.com/video/OTvtHkCNzlNE/, time 0:58] But he didn't say anything about a new type of white clots even though he said he has seen a lot of clots. And in another interview of O'Looney dated September 1st 2021, he didn't mention any kind of clots. [https://rumble.com/vlyri3-uk-funeral-director-seeing-alarming-rise-in-deaths.html]
There were 16 tweets which matched the search phrase from:olooneyjohn until:2021-12-31 clot
, but none of them mentioned anything about a new type of white clots. [https://twitter.com/search?q=from%3Aolooneyjohn%20until%3A2021-12-31%20clot&f=live]
In March 2024 John O'Looney was on InfoWars. When Alex asked O'Looney when he first started seeing the new clots, he answered "in 2021 - early 2021 - I saw a video by a guy called Richard Hirschman", and that soon after that he started seeing the clots himself. [https://rumble.com/v4gnag3-alex-jones-2-of-4-friday-3124-john-olooney-mortician-links-covid-jabs-and-b.html?start=652] But of course Hirschman wasn't even doing videos until January 2022.
At time 25:30 O'Looney said that "there were no extra deaths in 2020". Even though if you look at monthly excess ASMR for England and Wales at Mortality Watch, 3 out of the 5 months with the highest excess ASMR since 2020 the start of were in 2020, and the month with the highest excess deaths was by far April 2020. [https://www.mortality.watch/explorer/?c=GBRTENW&ct=monthly&e=1&df=2020%2520Jan&bm=lin_reg] O'Looney's funeral home is located about 50 miles from London, and the area of London was hit particularly hard during the COVID wave in the spring of 2020.
At time 20:23 O'Looney said he has had a bunch of people in their 40s and 50s dying of cancer. But in reality cancer mortality among people in their 40s and 50s has not been elevated in England since the vaccine rollout. [https://x.com/UncleJo46902375/status/1844420592453427663]
At time 27:04 O'Looney told a story about how he was invited to a secret meeting in London (akin to the whistleblower who told Bill Ryan about the Anglo-Saxon Mission):
And in September of 2021, I took a call from a guy called Mark Sexton, who's a retired police constable here in the UK. He invited me to meet in Westminster, a place called Birdcage Walk. So I attended this meeting in September - the 28th, I believe - of 2021. And present at the meeting were professor Dolores Cahill, Dr. Tess Lawrie, Dr. Sucharit Bhakdi, Dr. Steven Frost, Dr. Sam White, a lawyer and a debissare, and Philip Hylen, a barrister called Francis Hall, and a minister, very senior government minister by the name of Sir Graham Brady. Now Sir Graham is the commissioner of something called the 1922 Committee - and politics vary from country to country - but this is a guy who's the commissioner of a group of men who hire and fire prime ministers in this country, so there is no one above him politically.
So we all had five minutes because their time is precious. And I abbreviated basically what I've kind of skimmed over what I've said. And I then listened as it went round the table, all tenents told Sir Graham Brady their concerns.
And I'll be honest, I just couldn't believe what I was hearing. They said that people that have had an active ingredient will die between years two and five. And that there was no cure if they'd had an active ingredient. My jaw was on the on the table.
Then Sir Graham actually openly admitted it was above his pay grade, and he could do nothing about it. And he said whilst he would try, he couldn't promise anything. And at the end of the meeting, it was put to him by a number of us that when people find out what you've done, there will be civil unrest the like that we've never seen, there will be civil war. I'm still convinced there will be civil war if we don't stop this.
Then at time 33:46 O'Looney suggested that there were many large prisons constructed in the UK because dissidents were going to be jailed during the next pandemic, which he predicted would happen shortly after May 24th 2024. And he said 5G would be used to trigger symptoms of sickness in vaccinated people whose bodies contained graphene oxide and nanotechnology:
Well, there are two major things that concern me. I mean, I'm 56 years old. And I've seen many governments come and go. They all make manifesto promises they never ever keep.
Well, one of those promises is successive home office ministers have promised to ease prison overcrowding. They've never ever done anything about that. And yet they've chosen a time when they're - allegedly we're in the middle of a deadly pandemic - and we have the worst economic downturn since World War II to build loads and loads of huge multimillion pound prisons, huge super prisons in the middle of a pandemic and the worst economic downturn. You know, why would we need huge super prisons?
The other thing of real concern is the 5G network has gone up now. Now, I've skimmed over the technology. I've spoken to many people who have reached out to me, who tell me this 5G network can - has the ability to influence nanotech and graphene oxide that is inside jab recipients, so that when certain frequencies are put out, it can induce adverse reactions in these recipients.
[…]
I believe that's going to happen shortly after May the 24th. And you know yourself Alex, these people are saying this. They're crazy. They're into numerology. And I'm kind of wondering if it will be perhaps the 6th of June, or something like that, where it has real resonance with that. I think shortly after they install the who, they're going to declare another pandemic. And they've got the numbers now to be able to do that. And then we will see real tyranny across the western and developed world.
[…]
So I believe that come May the 24th, it's going to get very dystopian very quick. And you'll be aware yourself, these rats, they know the game is up. They know that the great reset is suddenly be morphing into the great awakening. So with that, these people have become particularly dangerous as they thrash about in the death throes of their plan.
O'Looney said that the bodies of people whose death was attributed to COVID were filled half full of fluid, because their kidneys had stopped working because of remdesivir poisoning: "What was happening in 2021, I was picking people up from an hospital - I was told had COVID, they died from COVID - and the body bag was like half full of fluid. And I've never ever seen that before in all my years. And I remember thinking at the time, 'What could that possibly be? Why is that? Why is that like that?' And they were all bloated, they were crying, yellow tears. And from the nose and from the ears. And even being generous, as you can't pull in the deceased over, you would mark them where, you know - because they're so bursting with fluid. And I've since found out, the remdesivir kills the kidneys so the body can't process fluid. So you fill up with fluid and you drown. And there's your respiratory illness, there's your COVID." [https://www.bitchute.com/video/svO5GNPHwaqC, 40:40] But his story doesn't seem believable at all. Has anyone else reported similar pathology associated with remdesivir poisoning? Why would the remdesivir victims be "crying yellow tears"?
What did O'Looney even mean with fluid, blood? Or lymph or water? Lymph is yellow in color, and there is a surprisingly large amount of lymph because a typical amount of lymph in an adult human body is about 1.5 liters. But ChatGPT said that AKI would not lead to buildup of lymph:
Acute kidney injury (AKI) does not directly cause a buildup of lymph, but it can lead to fluid overload, which may resemble or contribute to swelling (edema) that looks similar to lymphatic buildup in some cases.
What AKI does cause:
- Decreased urine output (oliguria or anuria)
- Retention of fluids and electrolytes
- Edema - especially in the legs, around the eyes, or even the lungs (pulmonary edema)
- Increased blood pressure
What AKI doesn't directly cause:
- Lymphedema, which is swelling due to blocked or damaged lymphatic vessels, is not directly caused by AKI.
- Lymph accumulation typically results from problems in the lymphatic system, not the kidneys.
However, severe AKI can worsen fluid retention, and if someone already has impaired lymphatic drainage, that excess fluid may further overwhelm the system and contribute to noticeable swelling.
On January 29th 2022 UTC Maria Zeee livestreamed a long interview with John O'Looney, but O'Looney did not yet say anything about a new type of white clots.
This time when he told the story about the secret meeting he had in London, he additionally said that 70% of vaccinated children were going to be sterilized: "Anyone who's had an active ingredient jab - i.e., not a clot shot, but the one that damages the immune system - has between two and five years to live. That's it. So they've got between two and five years to live. 70% of the children that are vaccinated will be sterilized as a side effect. And that was widely acknowledged. I watched reams and reams of scientific proof and evidence fell down on the table and be given to Sir Graham." [https://rumble.com/vtite4-john-o-looney-funeral-home-whistleblower-most-deaths-are-vaccine-deaths.html?start=3708]
The earliest tweets I found which referred to O'Looney talking about calamari clots were from late June 2022: [https://x.com/search?q=john%20o%27looney%20clots%20until%3A2022-8-1&f=live]
When I searched BitChute for videos of John O'Looney, there were about 600 videos posted before the oldest video I found where he talked about calamari clots, which was from late June 2022. [https://www.bitchute.com/search?query=%22john+o%27looney%22&sort=old] It's the same video the two tweets above referred to.
In the video O'Looney said the following: [https://www.bitchute.com/video/hn9R5OkfTRNW, 2:21]
We had a guy in today who obviously - I can't give too much detail respect for him and his family - but he was 30 years old, triple jabbed, and he had a post-mortem. So the family asks us to get him embalmed. And when that happens, basically they remove all the organs and put them in a plastic bag when they've done what they need to do - take samples and weigh them and look at them - and then they put them back in the body cavity and sew them up. So we have to undo that. And that then gives you obviously considerable access to that body from the inside.
And you could see all the crap hanging out of his arteries, this white stringy like. It's like a - I watched a report a little while ago from a guy called Richard Hirschman who's an embalmer in the US, and he mentioned about this, and he showed it to everyone. And there's a number of videos illustrating what it is, because we thought it was blood clots that were killing people. It's not. There's some sort of white crap that's growing inside people's arteries and it's phenomenal. It was honestly chilling to witness.
And I pulled it out of - every artery this guy had was chock-a-block full of stuff - the femoral artery, the radial artery, the carotid artery in the neck - literally you're pulling it out like spaghetti. And it grows inside the arteries, when it grows to - I mean, his aorta was literally jam packed full of it. What it is, I really don't know. It's very elastic. And it obviously cuts down the bigger it grows - it cuts down the blood supply to everywhere, and these people drop down dead, you know.
So O'Looney made it seem like he was not normally seeing calamari clots, but the reason why saw them in the case of the 30-year-old man was because the man had gotten a post-mortem examination.
O'Looney also said: "We thought it was blood clots that were killing people. It's not. There's some sort of white crap that's growing inside people's arteries." But later he claimed that he started seeing the calamari clots around mid-2021. So wouldn't he have already suspected long before June 2022 that people were killed by calamari clots and not regular blood clots?
In a video published on July 6th 2022 UTC, O'Looney told the same story again on a video panel which featured the "former European forces member Maverick Black" and two other people. O'Looney said: "I've never, ever seen it before, ever in 15 years of doing embalmings and opening people up and seeing the inside of them. And this is something very unique. I've heard of being reported that we've struggled to embalm people for about 18 months now - who are job recipients. Now, usually they're what was called a one-pointer for doing embalment. And the way that goes is we go in the carotid artery, and we make an incision halfway through. And an L-shaped pump is put in to pump formaldehyde round one way, using the material system. They then take that out, tie artery off, and go in the top to do the rest of the head. Now, one incision is usually enough - unless this person is very old and was diabetic, perhaps, and known to have poor circulation, then you would have to make - but every one of them now is what's called a six-pointer, so we have to go in both sides, both arms, and both femoral arteries as well. Because you just can't get the fluid round them. And I would suggest that's because their arteries are full of that." [https://www.bitchute.com/video/aDoOHVuKWEtN/, time 27:36] And later O'Looney said: "You rely really on someone coming through who's had a post-mortem, because then you're going to open up the cavity and you're going to see all these arteries that have been cut, and down - you're going to be able to look down them. And that's how we really discovered it with this guy. You know, people that haven't had a post-mortm - you're not opening them up as such, you're just making one incision. So, you know, they become apparent that they probably have got this. I knew what I was going to find because we struggled to embalm people for some time, to the point where we suspected the pump might need servicing. But it's got a pressure gauge on it that shows there's nothing wrong with the pump. It's the people's circuitry system blocked. And I knew what we would find. I kind of pre-warned Maverick before we did it. And I suspected what we'd find, and lo and behold it was there."
So this time O'Looney explicitly said that he saw the calamari clots for the first time only now, even though he said his funeral home had earlier had trouble embalming bodies because the veins were blocked by the clots. However it conflicts with the story of other embalmers like Hirschman, who say that the calamari clots get pushed out along with the blood when the embalming fluid is inserted. So are the clots more sticky in England than the United States, so that they remain attached to the arterial walls in England but not in the United States?
From the video I didn't understand why O'Looney was communicating with the "former European forces member Maverick Black". Maverick Black has a channel on Odysee but the only video on the channel is the video he did with O'Looney. [https://odysee.com/@MAVERICK:8b?view=content]
During one interview Hirschman said: "Well, as we're pushing fluid in, and we're not getting fluid into - like say, we'll just pick on the left arm - left arm's not getting fluid - and we can tell by the color of the arm - and so we're forced then to raise and an like an axillary or brachial up in the armpit or in the upper arm - to find the artery that feeds that limb, okay. And as I cut into the - open the artery up, I began to - you could see there was a clot inside." [https://rumble.com/v1o6sik-embalmer-richard-hirschman-the-ultimate-interview-with-photos-and-explanati.html?start=552] So if O'Looney was not able to push embalming fluid to some part of the body because it was blocked by a calamari clot, wasn't he able to tell it from the color of the part of the body that was blocked, and couldn't he have also made another incision to remove the clot?
O'Looney even said that "every one of them now is what's called a six-pointer, so we have to go in both sides, both arms, and both femoral arteries as well". [https://www.bitchute.com/video/aDoOHVuKWEtN/, time 28:20] So if he made six incisions then wouldn't he also have been able to see if there were calamari clots next to the spots he did the incisions in? And couldn't he have used the foreceps to pull out a clot even if it was several centimeters away from the incision?
In November 2022 John O'Looney was interviewed by DeAnna Lorraine on the Stew Peters Network. [https://rumble.com/v1qzlmo-like-long-calamari-mortician-john-olooney-shocking-things-hes-seeing-in-the.html]
O'Looney said: "One guy that reached out to me called Nick - who's a mortuary manager at a big hospital down south here - he's seen a five to six hundred percent increase in what he thinks are thrombosis deaths. They're not, it's the - your arteries filling up with this white crap, that behaves like a thrombosis. What does a thrombosis do? It blocks veins and arteries and stops blood flow. That's what this stuff is doing, so they automatically label it as a thrombosis." [37:27]
However based on the data for England at Nomis, deaths with an underlying cause of thromosis or embolism were only slightly elevated in 2021 (and it might have been due to COVID and not vaccines): [https://www.nomisweb.co.uk/query/161.1/advanced.aspx]
Next O'Looney said: "In the last 18 months I've looked after more people under 50 years old than I've ever seen, ever. To give you an idea, when I worked for the co-op, I could count the amount of people on one hand under 50 that died in a 12 month period. And this was, in a branch, doing about eight hundred, seven-eight hundred funerals a year. Now I've had that many, sometimes in a month, as a small family funeral director." [39:58]
However based on data for England from Nomisweb, ages 0 to 49 had only about 8% more deaths in 2021 than 2018, and even less deaths in 2022 than 2021:
John O'Looney claims these photos were sent to him by a surgeon who removed the clots from living people: [https://x.com/OlooneyJohn/status/1797976412860629014]
O'Looney described the clots as "white fibrous clots", but they look more like red, even though I don't know if they would be white if they were washed of blood.
This clot looks unusual because the piece in the middle looks flat and wide, but blood vessels are not actually flat:
When I searched Google Images for the photo, I found this photo of a clot with a somewhat similar shape (even though it's shaped more like a real bronchial tree than O'Looney's clot):
This pulmonary embolism is thinner like O'Looney's clot, but different parts of the tree are not connected unlike O'Looney's clot: [https://www.instagram.com/medical_neurology/p/Cn9o_FJIdJI/]
John O'Looney said this photo of a "white fibrous clot" (which actually looks red) was given to him by a surgeon who removed it from a living person: [https://x.com/OlooneyJohn/status/1797976412860629014]
When I asked ChatGPT what part of the human circulatory system would have the same type of branching pattern as the clot, it answered: > Based on the branching pattern, size, and overall morphology, this clot is most consistent with a pulmonary embolism (PE) that was removed from the pulmonary artery tree. Here's why: > > ### Clues: > > - Central trunk with bilateral branching, similar to how the main pulmonary artery divides into the right and left pulmonary arteries, which then branch further into the lungs. > > - This kind of large, complex clot is typical of a saddle pulmonary embolism, which straddles the bifurcation of the pulmonary artery and extends into both lungs. > > ### Procedure likely used: > > - Pulmonary embolectomy: This is a surgical procedure done to remove a life-threatening clot from the pulmonary arteries, especially in massive or saddle PEs. > > This is a rare and dramatic finding - removal like this usually happens during emergency open surgery or catheter-based intervention
The photo below was given the caption "Pre-thrombectomy pulmonary angiography of the right and left lungs demonstrating a saddle pulmonary embolism with large thrombus burden". It includes both halves of the tree like O'Looney's clot, even though the branches on the left are not connected to the rest of the clot. And the middle segment which connects the two halves is not flat and wide like in O'Looney's photo: [https://www.intechopen.com/chapters/82376]
O'Looney also posted the video which I believe he is supposed to have received from the same surgeon. He wrote "White fibrous clots being removed from a living vaccine receipient supplied to me via the person the surgeon removing them sent it to Im sure you can hear what he says - it is one of many": [https://x.com/OlooneyJohn/status/1804111560899530809]
John O'Looney has been saying that the pandemic was fake since 2021. In 2024 O'Looney tweeted: "The only way the 'virus' which doesn't exist will 'find' the unvaccinated it via 5G as targeted individuals of that tech". [https://x.com/OlooneyJohn/status/1849813034170032309] He has also shared videos by people like Andrew Kaufman and Jamie Andrews, and he has posted many tweets about how there was no COVID virus. [https://x.com/search?q=from%3Aolooneyjohn+virus&f=live]
However in January 2022 after he had been admitted to an ICU for COVID, he wrote: [https://rairfoundation.com/shocking-escape-covid-whistleblower-abused-in-uk-hospital-rescued-by-friends-interview/]
I was recently admitted to the ICU in Milton Keynes hospital after developing Covid symptoms.
I took three lateral flow tests whilst there and was told at the time I was not positive only to be told later on the ward I was positive so clearly it was inconclusive so I will say I felt and feel terrible still.
[…]
I was initially sceptical about Covid but I can confirm it's validity and it is very nasty. But I can also tell you it is 100% man-made this is not a natural virus and this is an attack on all of us - it's a bio weapon.
In 2024 O'Looney quoted a tweet by Sean Adl-Tabatabai which said:
Pfizer Insider Reveals Vaccinated People Will Soon Start 'Bleeding From Every Orifice'
Covid vaccinated individuals contain dormant nanopathogens in their bodies that can be activated by an 18 gigahertz signal on the 5G network, according to a Pfizer insider who reveals that once triggered, these pathogens can cause catastrophic health effects, ranging from sudden heart and brain explosions to uncontrollable bleeding from every orifice.
And O'Looney included this text in his tweet: [https://x.com/OlooneyJohn/status/1853739823086915792]
My understanding is the 5G masts, your own routers and smart phones will deliver the frequencies to resonate the Graphene oxide that is already inside you, it will act as razor blades as it resonates under the certain frequencies and cut and slashes its host internally - there is your "hemorrhagic fever" which is reality is simply remote mass murder..
You will bleed.
Graphene is the strongest, thinnest, and most conductive material known to man.
It's 40 times stronger than diamond and 300 times stronger than structural steel and it will chop you up like a fresh fillet steak if it resonates inside you and you are full of it.
Jim Ferguson is promoted by the same bots that promote accounts like John O'Looney, toobaffled, and SenseReceptor (which have all promoted videos about the clots by Greg Harrison's team along with Jim Ferguson). But here O'Looney retweeted a tweet about graphene oxide by Jim Ferguson:
In July 2021 O'Looney posted a TikTok video of a guy who was supposed to be a 5G installer, who said that his job was to install 5G kits which he was told to not crack open. But when he tried opening one kit, it contained a circuit board which said "COV-19". [https://twitter.com/OlooneyJohn/status/1419982639415631873] Then O'Looney commented "Just imagine having the ability to induce blood clots and vaccine recipients over Wi-Fi…":
However Reuters said this about the 5G video: "The circuit board was actually taken from a Virgin Media box for cable television - the casing of which can be seen on the bonnet of the van as the camera pans at the end of the footage. Virgin Media confirmed to Reuters it believed the circuit board had been taken from an old TV box, and the 'COV-19' engraving was not authentic." [https://www.reuters.com/article/idUSKBN22R35E/] So it might even be that the people who made the video left the casing of the box visible so the video would be easier to debunk.
Many anti-vaxxers suspect O'Looney of being controlled opposition who is attempting to discredit anti-vaxxers: [https://x.com/Jikkyleaks/status/1804717634270978122]
John O'Looney has posted articles from The People's Voice or Slay News which say that:
If O'Looney was sincere, would he really take stories like this seriously? It seems like O'Looney or whoever runs his account is deliberately promoting false information.
In June 2022 Jane Ruby said that an anonymous embalmer had contacted her and sent her photos of clots they had taken. This was one of the photos she showed: [https://rumble.com/v196g5d-live-new-embalmer-steps-forward-with-horrific-post-jab-clots.html?start=1145]
The photo looks suspiciously similar to Richard Hirschman's photos, because even the glove has a similar blue color as the gloves in Hirschman's photos. When I searched Google Images for "embalming glove", a lot of gloves were yellow or orange or white or black. And even blue gloves often had a different shade of blue than the gloves in the photos by the anonymous embalmer and Richard Hirschman:
I tried searching Google Images for embalmer mortuary
and I picked photos where a glove was clearly visible. I excluded duplicate photos of the same person, and I excluded photos that looked like staged stock photos where the people may have been actors. I also excluded one photo that showed embalming students, one photo of a person who was shown in the role of a funeral director and not an embalmer, and one grayscale photo where it was not possible to determine the color of the gloves. Out of the first 12 photos that passed my criteria, only 5 out of 12 people in the photos had blue gloves, even though 2 of the people had gloves that looked like a lighter shade of blue than Hirschman's gloves:
In September 2024 Hirschman posted this photo of a clot which he said he received from an anonymous embalmer, but the glove in the photo had a similar shade of blue as the gloves of Hirschman and the anonymous embalmer interviewed by Jane Ruby. The photos by both anonymous embalmers even had a vignette effect where the edges of the photo had been made darker, and they employed an effect of local enhancement of contrast similar to an unsharp mask filter with a high radius (even though I guess it's possible that both anynymous embalmers were the same person): [https://x.com/r_hirschman/status/1832561722743259646]
Below you can see the photos by Jane Ruby's anonymous embalmer and Hirschman's anonymous embalmer side by side with one of Hirschman's own photos. [https://x.com/r_hirschman/status/1914837898081223115/photo/2] All photos have a vignette effect and a local enhancement of contrast similar to an unsharp mask filter with a high radius (even though I don't know if effects like that are commonly applied by camera applications on cell phones):
When I did a reverse image search for the photo by Jane Ruby's anonymous embalmer, I found that the photo was included in an article by New Tang Dynasty from September 2023, where it was given this caption: "A series of 'white fibrous clots,' Richard Hirschman pulled out of a body. 'They are similar to calamari. The white stuff is in your face, like 'something is wrong,' Mr. Hirschman said. (Courtesy of Mr. Hirschman)". So NTD presented the photo as a photo by Hirschman, even though Jane Ruby said it was a photo by an anonymous embalmer who corroborated what Hirschman was saying: [https://ntdca.com/exclusive-embalmers-speak-out-on-unusual-blood-clots/]
The article by NTD was originally published by Epoch Times but it's behind a paywall at Epoch Times. [https://www.theepochtimes.com/world/exclusive-embalmers-speak-out-on-unusual-parasite-blood-clots-5121795] Epoch Times and NTD are both run by Falun Gong, whose leader declared himself as the Lord Buddha of the Universe (宇宙主佛) who was several times higher than Buddha and Jesus. He also claims that disembodied alien souls have taught humans how to develop technology so that humans will build clones which can be inhabited by alien souls, and then the aliens will trick humans into outlawing natural reproduction, so only clones that are inhabited by alien souls will be left on the earth. [https://time.com/archive/6954898/interview-with-li-hongzhi-2/]
The article by Epoch Times included comments by several people, who were Richard Hirschman, John O'Looney, Ryan Cole, "Dr. Roger Hodkinson, CEO and medical director of Edmonton-based MedMalDoctors", "Sarah, who is going to school in Wisconsin to get her funeral director's licence", and "Carolyn, a funeral home director in Ontario with more than 25 years of embalming experience". There was no source given for the comments by any of the people, so the people appear to have been interviewed by Epoch Times.
When I searched for text in the Epoch Times article in double quotes, I found that parts of a similar article had earlier been posted on some random website in late 2022. [https://web.archive.org/web/20221206095726/https://pennybutler.com/funeral-directors-covid/] The source linked on the website was a document at Google Docs, which seems to have been a draft version of the article that was later published by Epoch Times. [https://docs.google.com/document/d/1Pbn3w73ZW04VJrg4DA7ZUzJWx2YPVJEZ75nkmk2pjRk] The document was created in October 2022, but the author of the document is not shown anywhere:
The draft version of the article at Google Docs said: "Three embalmers provided photographs they personally took of the clots to the Western Standard." But the author of the Epoch Times article was Matthew Horwood, who also writes for Western Standard.
But anyway, the article by Epoch Times also had another interesting parallel with Jane Ruby's video, which is that Jane Ruby's anonymous embalmer said that the calamari clots appeared to be feeding on regular blood clots, which is also what the funeral home director Carolyn said in the Epoch Times article.
The draft version of the Epoch Times article included the following three paragraphs (but the first and third paragraphs were removed from the published article): [https://docs.google.com/document/d/1Pbn3w73ZW04VJrg4DA7ZUzJWx2YPVJEZ75nkmk2pjRk]
While normal blood clots are dark brown in colour, Carolyn said the fibrous masses are white. But she said they also have a pinkish tone, as they are "literally feeding off of blood clots."
"They remind me of parasites, because they're creating a blood clot and they're feeding off it," she said. "So every tentacle is basically down a part of the circulatory system, and at the end of those fingers there is a normal clot, and it looks like they're feeding off it."
Hirschman also said that the fibrous clots appeared to be feeding off normal blood clots.
In the video where Jane Ruby showed the photos by the anonymous embalmer, Jane Ruby also showed the photo below and said: "And notice the red, you know, sort of embedded clot like - you know, these things - these things are not just next to clots, they are actually attached in some cases. You'll see in a minute. And again, this particular embalmer said to me to that effect, and I didn't prompt the embalmer with Mr. Hirschman's comment - remember Mr. Hirschman's said it kind of looks like the white fibrous thing is emanating out of a regular blood clot, like it's feeding out of it. This embalmer - whose picture you're seeing right now, 'Normal, NOT Normal' - said it looks like it's being fed by the blood clot. Like unsolicited on their own, they said this. Uh, I thought that was stunning." [https://rumble.com/v196g5d-live-new-embalmer-steps-forward-with-horrific-post-jab-clots.html?start=532]
And next Jane Ruby showed the photo below and said: "This one is, it's number 105. And I called it the fish. Because it's disgusting. And it looks like a fish. And it's really gross. You see how that clot on the right upper - like it's sort of at the top - but sort of the second half to the right - and it's a long, sinewy clot. And it appears to go underneath the white fibrous clot. And it almost has like vessels in the mid center there. And then further up on the top of this piece, it's there is a clot that appears to be under the sheath. Right? Like under a little bit of this thing. And then of course on the bottom part of length wise of this piece, you see this long black - it does look like it's feeding on the blood. And this could be a clue. Because this is the second time an embalmer has said this to me, okay. Really horrific, isn't it?" [14:40]
Apart from Hirschman, Jane Ruby's anonymous embalmer, and Carolyn who was interviewed by Epoch Times, a fourth mortician who has said that the calamari clots appear to be feeding on regular blood clots is Laura Jeffrey. She said: "Then there's a blood clot that is integrated into the end of those tentacles. It felt like it was a parasite that was feeding off a blood clot that it created in the body. When you think of a parasite, you think - Because it feeds off of something, right? Then you see the jelly clots at the end of this parasite. You see those and you think, 'Are they feeding off us as humans? Out of our circulatory system?' Because they always had the currant jelly integrated at the ends." [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf]
It seems unusual that four different morticians would use terminology that one type of blood clot was feeding off another type of blood clot. It should be clear that the calamari clots don't even have a digestive system so that they could eat and digest biological material, but both Laura Jeffrey and Carolyn seem to have said that the calamari clots were literally feeding on regular blood clots.
Laura Jeffrey is a Canadian funeral director and embalmer. The earliest place I found where she said she saw calamari clots was in her testimony to the Canadian National Citizens' Inquiry in August 2023. [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf, https://rumble.com/v2fuj08-licensed-funeral-director-laura-jeffery-on-post-vaccine-embalming-nci.html]
She Jeffrey said that the new type of clots reminded her of parasites, and then she said the new type of clots were feeding off the "currant jelly clots":
The first time I saw it I thought it was a parasite. We have something called drainage forceps. I use a pair, generally speaking, that are about this long and that have a handle port. You can squeeze them like tweezers, right? So curved tweezers, think of them that way. I use that to pull anything out of the way on the venous side of the body, where you're draining the return blood. And all of a sudden, I was having trouble. I couldn't understand. Then I pulled it out and I went and I kind of - You can turn the drainage forcep and you can see what's in it. I'm sort of like this and I see something that I thought was a tapeworm. Which was weird, because tapeworms shouldn't be in a circulatory system. And then I'm looking at this and I'm thinking, "Is this a parasite?" Because a tapeworm's a parasite; that looked like a parasite. And it was at that point, maybe, like three, four inches long. That's a small one. But at that point, that was a huge one for me, because I'd never seen this before. This was a whole new anomaly.
[…]
Okay. Have you ever seen those erasers that you push out and they're like a pen, but they're a circle? They're round, cylindrical. You think of one of those but then it maybe has a couple of little tentacles of eraser coming out the end. Then there's a blood clot that is integrated into the end of those tentacles. It felt like it was a parasite that was feeding off a blood clot that it created in the body. When you think of a parasite, you think - Because it feeds off of something, right? Then you see the jelly clots at the end of this parasite. You see those and you think, "Are they feeding off us as humans? Out of our circulatory system?" Because they always had the currant jelly integrated at the ends. It's something to see, let's put it to you that way. It's horrific.
Laura Jeffrey also tweeted: "Yes … a regular current jelly clot is often incorporated in the end of the amyloid clot … which is confusing … is it feeding from our blood OR is it simply stopping blood flow and the current jelly clot is created?" [https://x.com/LauraJayJayJay/status/1807896656047636666]
Laura Jeffrey seems to have somehow worked together with Tom Haviland and Laura Kasner in running one of their surveys, because in 2024 she tweeted: "Ret'd USA Major Thomas Haviland amd Laura Kasner have created a World Wide Survey. If you or someone you know has suffered clotting since 2021 and needed Surgery or Catherization because of clots, please take 3 minutes and fillout this survey:" [https://x.com/LauraJayJayJay/status/1829476769222537242] When someone asked her to link to the survey, she replied "Working on it!", and then in another reply she linked to a page for the survey at Survey Monkey:
She posted this reply to a video of military personnel marching: "In the 90s … if we marched like that, we'd be punished. And that was the Airforce Cadets." [https://x.com/LauraJayJayJay/status/1898781555314569324] So she seems to have been trained as a cadet in the Air Force (even though it's not clear if she later served in the Air Force, or if she meant the Canadian or US Air Force). She also tweeted: "I wouldn't join any organization that thinks they own my mind, body, heart and soul. The military's medical system kept me out 30 years ago." [https://x.com/LauraJayJayJay/status/1789305430394466661]
Maybe it's just a coincidence, but there seem to be several Air Force people involved with the story about the calamari clots, because Tom Haviland is also a retired Major General in the US Air Force. And the Died Suddenly movie included a long segment about the DMED data that was presented by Theresa Long and Pete Chambers, who are both medical officers in the US Air Force. And supposedly Richard Hirschman was first connected to Jane Ruby by Theresa Long, who found Hirschman by chance because she happened to visit a funeral home where Hirschman was doing embalming.
When I searched for tweets about Laura Jeffrey, I found that her testimony for NCI Canada was posted by SenseReceptor and bambkb, which are both part of a network of accounts that post video clips from controlled alt media and that are artificially amplified by bots: [https://x.com/SenseReceptor/status/1645901270463442945, https://x.com/bambkb/status/1701720910548307973]
Videos of her testimony were also posted by many accounts which promote Miles Guo (which are probably bots but some of them might be manually ran "ant" accounts): [https://x.com/search?q=funeral+director+laura+jeffery&f=live]
In another tweet where bambkb wrote about Jeffrey's testimony, he also posted a video an alternative health practitioner Kelly Blacher said that after the COVID vaccines were rolled out, people's blood has contained self-assembling structures that glowed in the dark, and she said: "And then they are morphed into whatever organism I'm looking at. They look crab-like, or squid, or like something - it looks like tentacles, segmented tentacles, kind of like a spider. But I never saw these things before. Never. And then there's the metallic kind of looking pieces that eventually degrade, but that turn into a living thing." [https://x.com/bambkb/status/1642948624383352834]
In 2022 Brenton Faithfull told Matt Shelton that about 95% of people who passed through his funeral home had been vaccinated within two weeks: "When I started counting in the August of last year, it was one after the other, after the other, after the other. And when I got to 20, there was 19, 19 who had died within two weeks. So carrying on from 20, so the first 20 years, I counted 19 of them, so it's 95%. The next, number was 100% of the people who died had been vaccinated within two. So it depends when the booster has come out, and the first and the second vaccine has come out, and then the booster, it'll go on a wave. So, you know, 100%, and then it'll drop to 90%. So I've got the statistics, 95% of the people who have passed away - through the work that I've done - has been vaccinated with the two weeks." [https://rumble.com/v1lsnnq-brenton-faithfull-funeral-director-speaks-to-dr.-matt-shelton-about-what-he.html?start=978] At time 32:02, Faithfull also said that at the height of the first and second booster rollout, about 95% of all deaths he saw were in people who had been recently vaccinated.
However it doesn't match Barry Young's New Zealand dataset, which includes mortality data for about half of all vaccinated people in New Zealand. It has a very low number of deaths in the first two weeks after vaccination due to the healthy vaccinee effect (because people in hospice facilities or people who are currently ill are advised to not get vaccinated):
t=fread("https://github.com/skirsch/NewZealand/raw/refs/heads/main/data/nz-record-level-data-4M-records.csv.gz") for(i in grep("date",names(t)))t[[i]]=as.Date(t[[i]],"%m-%d-%Y") a=t[,.(dead=.N),,.(weeks=as.integer(date_of_death-date_time_of_service)%/%7+1)] a[weeks>=0&!is.na(weeks)][1:10]|>print(r=F) # weeks dead # deaths by weeks after vaccination # 1 357 # week 1 is day of vaccination and next 6 days # 2 564 # 3 636 # 4 718 # 5 727 # 6 741 # 7 773 # 8 805 # 9 822 # 10 881
There is also a low number of deaths during the first two weeks after vaccination in the Czech record-level datasets, in the Medicare data Kirsch received from a source at HHS, and in the English ONS data: [rootclaim.html#Fenton_and_Neils_miscategorization_bias]
And anyway if 95% of deaths were in people who had been vaccinated within two weeks, does it mean that there was about 20 times the normal number of deaths? Faithfull didn't mention if deaths from other causes remained stable or not. And in either case around August 2021 when Faithfull claimed that about 95% of deaths were in recently vaccinated people, New Zealand had close to 0% excess deaths:
t=fread("NZL_NPstmfout.csv")[Sex=="b"] a=t[,.(year=Year,week=Week,age=rep(1:5,each=.N),dead=unlist(.SD[,5:9]),cmr=unlist(.SD[,11:15]))] a[,pop:=dead/cmr*100] a=a[week!=53] lm=glm(round(dead)~factor(age)+factor(week)+year,offset=log(pop),poisson,a[year%in%2010:2019]) a$base=predict(lm,a,type="response") p=a[,.(dead=sum(dead),base=sum(base)),.(x=isoweek(year,week,4))] yearly=p[,.(label=(sum(dead)/sum(base)-1)*100),.(x=as.Date(paste0(year(x),"-7-1")))] yearly[,label:=paste0(ifelse(round(label)==0,"",ifelse(label>0,"+","")),round(label),"%")] p=p[,.(x,y=c(dead,base,dead-base),z=rep(1:3,each=.N))] p[,z:=factor(z,,c("Actual deaths","Baseline","Excess deaths"))] xstart=as.Date("2015-1-1");xend=as.Date("2025-1-1");p=p[x%in%xstart:xend] ybreak=pretty(p$y,7);ystart=min(ybreak);yend=max(ybreak) xbreak=seq(xstart+182,xend,"year");xlab=year(xbreak) color=c("black","#2266ff","#ff5555") leg=p[rowid(z)==1,.(x=xstart+60,y=seq(400,,(ystart-yend)/16,.N),label=z)] ggplot(p)+ geom_vline(xintercept=seq(xstart,xend,"year"),color="gray92",linewidth=.4)+ geom_hline(yintercept=c(ystart,0,yend),color="gray65",linewidth=.4)+ geom_vline(xintercept=c(xstart,xend,as.Date(c("2020-1-1","2015-1-1"))),color="gray65",linewidth=.4)+ geom_line(aes(x,y,color=z),linewidth=.6)+ annotate(geom="label",x=as.Date("2022-7-1"),y=360,label=paste0("Total excess deaths in 2020\nto 2024: ",p[year(x)%in%2020:2024&z==levels(z)[3],round(sum(y))]," (about ",a[year%in%2020:2024,sprintf("%.1f",(sum(dead)/sum(base)-1)*100)],"%\nabove baseline)"),size=4,lineheight=.9,fill="gray90",label.r=unit(0,"pt"),label.padding=unit(4,"pt"),label.size=0,hjust=.5)+ geom_text(data=leg,aes(x,y,label=label),color=color[1:nrow(leg)],size=4.2,hjust=0)+ geom_text(data=yearly,aes(x,y=ystart,label=label),vjust=-.5,size=3.8,color="gray50")+ labs(title="Weekly deaths in New Zealand",x=NULL,y=NULL)+ scale_x_date(limits=c(xstart,xend),breaks=xbreak,labels=xlab)+ scale_y_continuous(limits=c(ystart,yend),breaks=ybreak)+ scale_color_manual(values=color)+ coord_cartesian(clip="off",expand=F)+ theme(axis.text=element_text(size=11,color="black"), axis.text.x=element_text(margin=margin(3)), axis.ticks=element_line(linewidth=.4,color="gray65"), axis.ticks.length.x=unit(0,"pt"), axis.ticks.length.y=unit(4,"pt"), axis.title=element_text(size=11), legend.position="none", panel.background=element_blank(), plot.margin=margin(5,5,5,5,"pt"), plot.subtitle=element_text(size=11), plot.title=element_text(size=11.6,face=2,margin=margin(,,4))) ggsave("1.png",width=6,height=3.5,dpi=300*4) sub="Source mortality.org/Data/STMF. The percentage above the year shows the total excess deaths on ISO weeks where the Thursday fell on the year. The baseline is a linear trend that is adjusted for seasonality and the population size of age groups. The baseline was calculated by doing a Poisson regression where the age group and week number were included as categorical variables, the year was a continuous variable, and the population size was the offset variable. The age groups used were 0-14, 15-64, 65-74, 75-84, and 85+." system(paste0("mogrify -trim 1.png;magick 1.png \\( -size `identify -format %w 1.png`x -font Arial -interline-spacing -3 -pointsize $[43*4] caption:'",gsub("'","'\\\\'",sub),"' -splice x80 \\) -append -resize 25% -bordercolor white -border 24 -dither none -colors 256 1.png"))
Faithfull said that after he started keeping records in August 2021, 39 out of the first 40 dead people had been vaccinated within 2 weeks. But he didn't mention if the one remaining person was unvaccinated, or if their vaccination status was unknown, or if they had been vaccinated 14 or more days ago.
So did almost everyone who died due to vaccination die within two weeks from vaccination, so that there were almost no people who died 14 or more days after vaccination? Even though the vaccines were rolled out late in New Zealand, most people aged 60 and above had already been vaccinated by the start of August 2021, and most people aged 18 and above had been vaccinated by the end of August 2021. But ages 60 and above accounted for about 87% of total deaths in New Zealand in 2021, so presumably they would've also accounted for most deaths that were handled by Faithfull's funeral home, and by August 2021 there should've been a lot of people aged 60 and above who had been vaccinated 14 or more days ago.
About two years after the interview with Faithfull, Matt Shelton told Philip McMillan: "Then we had an embalmer in New Zealand contact us and say, 'Look, I've been keeping a record, and 90% of the deaths that I am working with' - you know, funeral director an embalmer as well - seemed to him to be within - well he was keeping records - they were within two weeks of of being vaccinated. So they were predominantly elderly. But they all had this vaccine history, recent vaccine history. And he was finding these clots in the bodies he was embalming." [https://www.youtube.com/watch?v=FFJwkSaIVHE&start=23m16s] But Shelton didn't express any doubt about the validity of Faithfull's statistics, even though they were completely unrealistic.
Nicky Rupright King said that she was from South Alabama like Hirschman: "Richard Hirschman & I were 2/3 Embalmer's in South AL that came forward after John O'Looney in the UK in reference to the fibrinous clots." [https://x.com/Nickyalembalmer/status/1747807818516754826] The third embalmer she referred to might have been Cary Watkins, who did a short interview with Steve Kirsch in February 2022 where he said that he knew Hirschman and he was also seeing the new type of clots. [https://rumble.com/vuycmg-embalmer-with-50-years-of-experience-verifies-hirschmans-story.html] In January 2024 King wrote "I can vouch for Richard we have worked together for a few years." [https://x.com/Nickyalembalmer/status/1751830549549719943]
The only interview of Nicky Rupright King I found was an interview she did with Jason Liosatos in November 2022. [https://www.bitchute.com/video/3Ev4bzcLuj4e/]
At time 3:01 King showed the photo of a green clot below and said: "And myself and Richard Hirschman went into the embalming arena, adn worked on this gentleman for four hours. And we were able to get some drainage after a lot of work in massage. And this is one of the fibrodis substances and clots that we actually removed from this gentleman." I don't remember other morticians or Hirschman showing photos of similar green clots (even though King herself said that she had never seen a clot with a similar color before). I also didn't find the photo of the green clot posted elsewhere with reverse image search engines:
Next King said: "This one had little pods attached to it that were almost like a rubber substance. And I - if you look to the right of this, to the right of the one - and it's kind of smushed out onto the table - I actually took my finger and pushed down on that one to pop it to see what was inside of it and it just had like almost like a granuline substance. Almost as if you see a fatty piece of a steak that had that granule inside of it. And that is the one on the right that you could see draining down on the table." [https://www.bitchute.com/video/3Ev4bzcLuj4e/, 8:26]
In July 2022 Hirschman also showed the same photo of mysterious ball sacks on Jane Ruby's show: [https://rumble.com/v1cfcrx-white-clots-grow-mysterious-ball-sacks-america-is-flying-the-deadly-skies-s.html?start=355]
Hirschman said it was him and not King who popped open the ball on the right that had burst open: "Well, on one side of it, on the right side of the screen kind of close to where the table goes down into a little trough for drainage, I was curious too, it's so I took my finger and I started just kind of lightly pressing on it to see if I can break it up. And it did break up and mostly what it seemed like what was coming out of there was like blood, but it still was kind of the strands were still there." [7:42] Both Hirschman and King specifically even said that the ball they had burst open was the ball that was draining down the table. But I didn't find either King or Hirschman mentioning if they worked together to embalm the body with mysterious ball sacks, like how they are supposed to have worked together to embalm the body with the green clots.
Another unusual thing King said during the interview was that the white fibrous clots started "started happening in 2022 after the vaccines had been out". [13:12] So I don't know if she accidentally said 2022 instead of 2021, or if she later changed her story. In 2024 Richard Hirschman said that he began noticing strange clotting issues in early 2021 and he took his first photos of the clots in September 2021, and King replied that "I have seen the Clots from the beginning as well, & they continue to become worse". [https://x.com/Nickyalembalmer/status/1861978692051726754]
King also said she was able to tell whether the people she embalmed had been vaccinated based on the consistency of the rubbery clots: "We were at times trying to get a toll on who was vaccinated, who was not, to see if we could see a difference. And most of the time we could tell just by the consistency of the rubbery clots that they were vaccinated. And if I wait on a family and the person is deceased, I will ask, can you please tell me if they had their COVID vaccine? And nine times out of 10, they've said, yes, they have had the COVID vaccine." [20:03] However she didn't explain how the consistency of the clots differed between vaccinated and unvaccinated people. And she didn't even mention if she had even seen the clots in any unvaccinated people. Richard Hirschman said that he had seen the calamari clots in only two people who he knew were not vaccinated, but they were both people who had received blood products (where his implication seems to have been that the clots were formed due to some substance that was included in the blood of vaccinated people).
King was also telling dramatic stories about dead babies similar to Wesley the funeral director, John O'Looney, and Brenton Faithfull: "And to speak of fetal demise, after the vaccine had come out, I've seen so many fetal demises. […] And some of these poor babies were just born so deformed that - things I've never seen in my life before. I felt so bad for these parents who were having to come in and plan for funerals or cremations, memorial services, for their children. From eight months, nine months, to giving birth when they're only - the babies only three months old - the deformities that these children had were astronomical." [24:45]
During the interview with Jason Liosatos, Nicky Rupright King also said: "The time lapse between the people that we know that are vaccinated, because the family will tell us so, and the time of death - you can see a difference in each person as far as this - the size of the fibrinous clots that are growing - you can see if you've been - if in fact they've been vaccinated - let's say two years versus six months - there's a huge difference in the size of these clots. The consistency, the length of them - and as time goes by, we have noticed that they're starting to take route into whatever artery or vein that they're growing in." [37:46] So she seems to have suggested that it might take more than a year for the clots to reach full size, since she said there's a huge difference in the size of the clots between people who were vaccinated 6 months ago or 2 years ago. (Tom Haviland also suggested that it takes six months or more for the clots to grow, which would've explained why morticians only say they started seeing the clots in mid-2021. However what Haviland and King said conflicts with the hypothesis of the endovascular surgeon who sent a letter to McMillan, who speculated that the reason why he wasn't seeing the clots in his patients might have been if the clots formed rapidly right before death.)
In February 2023 someone called "Pistol Packing Pilot" posted a two-part interview of an anonymous embalmer. [https://www.youtube.com/watch?v=m29ouzFlkIk, https://www.youtube.com/watch?v=373n_Ymw_mQ] The embalmer sounded like Richard Hirschman whose voice had been slightly pitched up, but I don't know if it was actually him. However Pistol Packing Pilot also did an interview with Hirschman about two months earlier, which increases the likelihood that the person who played the role of the anonymous embalmer was actually Hirschman. [https://www.youtube.com/watch?v=m29ouzFlkIk]
The embalmer said that there was a very good friend of his who was a pilot for a US airline who died from a heart attack caused by clotting. [https://www.youtube.com/watch?v=m29ouzFlkIk&start=10m33s] Pistol Packing Pilot is also supposed to be "an Airbus A320 Captain flying for a major U.S. air carrier", and he has done a lot of videos about how airline pilots are supposedly dying from vaccines, which are similar to the stories promoted by Theresa Long.
At time 12:15 Pistol Packing Pilot asked: "Are you still seeing the same number of people who are passing away in their 70s, 80s, 90s? Or is it - you're saying the majority of them are 50s and 60s now?" And the anonymous embalmer answered "Yeah", and he said: "Nowadays it's rare to get someone - I mean, you know, if we do a case and you know, they're 75, 78, 81, something in that nature - that's a shock. Whereas used to - that was the norm, and the younger folks were the shock. Unfortunately, we've gotten to where the number of deaths at a younger age are rising, and that's surprising us. It's - I look for by the end of this calendar year for the number of younger deaths to be more than the number of older deaths. And that is unnatural."
The embalmers who claim to have seen the white clots often also claim that there is an increased number of deaths in younger age groups, but as a rule they never cite any actual published mortality statistics, and their anecdotal claims are not supported by real mortality statistics. In December 2023 in the United States, the median age of death was 77, and about 67% of deaths were in ages 70 and above:
t=fread("http://sars2.net/f/uspopdeadmonthly.csv") t2=t[year==2023&month==12] t2[,median(rep(age,dead))] # 77 t2[,sum(dead[age>=70])/sum(dead)] # 0.6690405
The percentage of deaths in ages 70 and above was about 65% in 2019, 2020, and 2022, but in 2021 it dropped to about 62% (even though it was partially because there the proportion of unvaccinated people was higher in younger age groups than older age groups, and in 2021 there were still a lot of unvaccinated people who had not yet acquired natural immunity):
o=t[,.(dead=sum(dead)),.(year,old=age>=70)][,.(oldpct=dead[old]/sum(dead)*100),year] print(round(o[year%in%2015:2023],1),r=F) # year oldpct # 2015 64.8 # 2016 64.0 # 2017 64.7 # 2018 65.1 # 2019 65.3 # 2020 65.1 # 2021 62.5 # 2022 64.7 # 2023 65.4
Laura Kasner is Tom Haviland's assistant who runs a Substack blog called Clotastrophe. In May 2024 she published a written testimony that she supposedly got from a local embalmer from Ohio. [https://laurakasner.substack.com/p/embalmer-testimony]
The embalmer said that he saw the first fibrous clot in March 2021, and that there was also a huge increase in deaths in the spring of 2021: "It was then that I began talking with some other of my colleagues and acquaintances that also work in the funeral business. Not only are they seeing these white fibrous structures as well, but every funeral home was INCREDIBLY busy, like off-the-charts record number of new calls. If we usually did 20 calls in the month of April, we did 50. The type of busy that everyone is just trying to keep their heads above water and make sure that families are satisfied with their care. Most funeral homes did about the same number of calls in 2020 as we had in years past, if not maybe a three to five percent increase at most, but if this keeps up, this is the real pandemic."
However as usual in the case of testimony by the morticians who claim to have seen calamari clots, Laura Kasner's anonymous embalmer did not refer to any actual mortality statistics, and his claim that there was about 2.5 times the normal number of calls in April 2021 is inconsistent with actual mortality statistics.
You can go to CDC WONDER: https://wonder.cdc.gov/mcd-icd10-provisional.html. Click "I Agree", switch "Group Results By" to month, and select Ohio as the state of residence from the second section. It shows that Ohio had a fairly low number of deaths in April 2021 because there was a low number of COVID deaths:
d=CJ(year=2018:2024,month=1:12) d$dead=c(12788,10167,10599,10392,10142,9590,9781,9704,9723,10154,10379,10845,11376,9767,11198,10200,10036,9796,9965,9952,9735,10247,10417,11028,11299,10387,11193,11514,11715,10514,11225,11391,10878,11834,13899,17851,15265,11682,11033,10673,10882,10122,10337,11402,12961,13738,13439,16101,17041,11991,11231,10207,10425,10159,10686,10744,10375,11176,11417,12757,11822,10201,11323,10583,10519,9982,10059,10021,10192,10921,10662,11528,12220,10729,11017,10386,10258,9929,9922,10250,9912,10580,10299,11259) d$covid=c(rep(NA,26),91,989,1053,466,608,703,557,853,2756,5529,3703,1366,600,556,460,235,164,737,2176,2486,2046,3756,4390,1729,475,148,171,224,302,430,357,303,368,436,428,213,232,159,97,74,33,72,171,174,216,306,304,144,89,57,31,25,72,108,153,97,73,106) p=d[,.(x=as.Date(paste(year,month,15,sep="-")),y=c(dead,dead-covid),z=rep(1:2,each=.N))] p[,y:=y/lubridate::days_in_month(x)] p[,z:=factor(z,,c("All causes","Underlying cause not COVID"))] x1=as.Date("2018-1-1");x2=as.Date("2025-1-1") xbreak=seq(xstart+182,xend,"year");xlab=year(xbreak) y1=0;y2=max(p$y,na.rm=T);ybreak=pretty(c(y1,y2)) ggplot(p,aes(x,y))+ geom_vline(xintercept=seq(x1,x2,"year"),color="gray75",linewidth=.5)+ geom_hline(yintercept=c(y1,y2),linewidth=.5,lineend="square")+ geom_line(aes(color=z),linewidth=.7)+ geom_point(aes(color=z),stroke=0,size=1.3)+ labs(x=NULL,y=NULL,title="CDC WONDER: Monthly deaths in Ohio divided by days in month")+ scale_color_manual(values=c("black","gray60"))+ scale_x_date(limits=c(x1,x2),breaks=xbreak,labels=xlab)+ scale_y_continuous(limits=c(y1,y2),breaks=ybreak)+ coord_cartesian(clip="off",expand=F)+ theme(axis.text=element_text(size=11,color="black"), axis.text.x=element_text(margin=margin(4)), axis.ticks=element_line(linewidth=.5), axis.ticks.length=unit(3,"pt"), axis.ticks.length.x=unit(0,"pt"), legend.background=element_rect(fill="white",color="black",linewidth=.5), legend.box.spacing=unit(0,"pt"), legend.direction="vertical", legend.justification=c(1,1), legend.key=element_blank(), legend.key.height=unit(12,"pt"), legend.key.width=unit(30,"pt"), legend.margin=margin(5,7,5,5), legend.position=c(1,.4), legend.spacing.x=unit(3,"pt"), legend.spacing.y=unit(0,"pt"), legend.text=element_text(size=11), legend.title=element_blank(), panel.background=element_blank(), panel.border=element_rect(fill=NA,size=.5), plot.margin=margin(5,5,5,5), plot.title=element_text(size=11.5,face="bold",margin=margin(,,5))) ggsave("1.png",width=6,height=2.5,dpi=300*4)
The Ohio embalmer also had a dramatic story to tell about dead babies: "We also saw an exponential increase in the number of fetal and infant deaths in 2021. From 2015-2020, you could count on one hand how many fetal deaths we had. It's not something that is very common. But in 2021, we had more than 10 fetal deaths in less than a year. We also had deaths in several month-old babies that were otherwise perfectly healthy. The family chalked it up to SIDS, but we found out later that the breastfeeding mother was given her Covid vaccine just days prior to the death of the infant. And she wasn't the only one that this happened to. 100% of the fetal and infant deaths that occurred in 2021 were born to vaccinated mothers. There were so many red flags occurring that we began asking every single family that we met with whether the deceased (or the mother of the infant) had previously had Covid or whether they had taken the Covid vaccination. We found that the bodies that had these weird clots inside them - about half of them previously had Covid, but 100% were vaccinated."
However according to CDC WONDER there was a low number of fetal deaths in Ohio in 2021: [https://wonder.cdc.gov/fetal-deaths-expanded-current.html]
In December 2024 NZDSOS published a testimony of an anonymous mortician on Twitter. [https://x.com/nzdsos/status/1867008577610846319] They gave her the pseudonym Diane. She said she saw calamari clots in about 1 in 3 embalmings.
She said that she started working in the funeral industry over a decade ago, but in the years before COVID she had only dealt with two unexpected deaths in people under the age of 70. But now after the vaccine rollout, she said that "the number of sudden deaths is up sharply, the youngest person that I had to take care of was only 21 years (died while getting ready to play rugby, fit and healthy). Sudden deaths are spread across all ages and are showing no signs of slowing down."
However according to the mortality statistics published by Statistics New Zealand, there hasn't been any major increase in deaths in younger age groups since the vaccine rollout: [https://infoshare.stats.govt.nz]
agecut=\(x,y)cut(x,c(y,Inf),paste0(y,c(paste0("-",y[-1]-1),"+")),T,F) t=fread("http://sars2.net/f/nzpopdead.csv")[year>=2010] a=t[,.(dead=sum(dead),pop=sum(pop,na.rm=T)),.(year,age=paste("Age",agecut(age,0:4*20)))] a=rbind(a,a[,.(dead=sum(dead),pop=sum(pop),age="All ages"),year]) p=a[,.(x=year,y=dead/pop*1e5,age)] p=p[,cbind(.SD,predict(lm(y~x,.SD[x<2020]),.SD,interval="prediction",level=.95)),age] p=merge(p,p[,.(ymax=max(y)),age]) xstart=2010;xend=2024;xbreak=seq(xstart,xend,1) color=c("black","#3333ff","#3333ff") lab=c("Mortality rate","2010-2019 linear trend (with 95% prediction interval)") lab=factor(lab,lab) ggplot(p,aes(y=ymax))+ facet_wrap(~age,dir="v",ncol=2,scales="free_y")+ geom_vline(xintercept=seq(xstart-.5,xend,5),color="gray80",linewidth=.4)+ geom_ribbon(aes(x,ymin=lwr,ymax=upr),fill=color[3],color=color[3],alpha=.2,linewidth=.3)+ geom_line(aes(x,y,color=lab[1]),linewidth=.6)+ geom_line(data=p[x<2020],aes(x,y=fit,color=lab[2]),linewidth=.6)+ geom_line(data=p[x>=2019],aes(x,y=fit),color=color[2],linetype="11",linewidth=.6)+ geom_point(aes(x,y,color=lab[1]),stroke=0,size=1.5,show.legend=F)+ geom_text(data=p[rowid(age)==1],aes(label=age,x=xstart,y=ymax/2),hjust=0,size=grid::convertUnit(unit(11,"pt"),"mm"),fontface=2)+ geom_text(aes(x,y=0,label=round((y/fit-1)*100)),size=3.5,vjust=-.4,color="gray55")+ labs(title="Yearly deaths per 100,000 people in New Zealand",subtitle="Source: infoshare.stats.govt.nz. Excess death percent is shown in gray.",x=NULL,y=NULL)+ scale_x_continuous(limits=c(xstart-.5,xend+.5),breaks=xbreak)+ scale_y_continuous(limits=c(0,NA),breaks=\(x){y=pretty(x,5);y[y<.95*max(x)]},labels=\(x)ifelse(x>=1e3,paste0(x/1e3,"k"),x))+ coord_cartesian(clip="off",expand=F)+ scale_color_manual(labels=lab,values=color)+ theme(axis.text=element_text(size=11,color="black"), axis.text.x=element_text(margin=margin(3),angle=90,vjust=.5,hjust=1), axis.ticks=element_line(linewidth=.4,color="black"), axis.ticks.length.x=unit(0,"pt"), axis.ticks.length.y=unit(3,"pt"), legend.background=element_blank(), legend.box.spacing=unit(0,"pt"), legend.justification="left", legend.key=element_blank(), legend.key.height=unit(13,"pt"), legend.key.width=unit(25,"pt"), legend.margin=margin(,,5), legend.position="top", legend.spacing.x=unit(2,"pt"), legend.text=element_text(size=11,vjust=.5), legend.title=element_blank(), panel.background=element_blank(), panel.border=element_rect(fill=NA,linewidth=.4), panel.spacing.x=unit(3,"pt"), panel.spacing.y=unit(4,"pt"), plot.margin=margin(5,5,5,5), plot.subtitle=element_text(margin=margin(,,3)), plot.title=element_text(size=11.3,face=2,margin=margin(2,,4)), strip.background=element_blank(), strip.text=element_blank()) ggsave("1.png",width=5.7,height=4.2,dpi=300*4) system("mogrify -resize 25% -dither none -colors 256 1.png")
Diane's testimony was published at the end of 2024, and in 2024 New Zealand had close to 0% excess deaths. Also New Zealand had close to 0% or even negative excess deaths in the first year after the vaccine rollout, but the excess deaths only shot up in March 2022 when New Zealand was first hit by COVID:
Diane also said that she saw lots of turbo cancer:
The other noticeable difference is in cancer: much more but especially in the young.
Before the vax, my observations were that the time between the first diagnoses and death was at least a year minimum (there were some exceptions), now the majority are less than 3 months.
I looked after a younger person not so long ago, the time between diagnoses and death was 4 days….. there are no words……
Not surprisingly she also had a dramatic story to tell about dead babies:
Then the dramatic increase in late term miscarriages, and still births, was very obvious.
For example, we usually took care of up to three babies within a two-month period, (which is already too many; one of the hardest aspects of the job). The first week of the vax, we had three babies born dead in the same week!
Were these partners of vaccinated border workers? I don't remember the 'safe in pregnancy' message being pushed until after that.
Guy Hatchard doesn't appear to be a member of NZDSOS, but NZDSOS praised him as one of New Zealand's best analysts. [https://nzdsos.com/2023/01/18/hatchard-therapeutic-products-bill/] In 2023 Hatchard published fake data which he claimed he received from an anonymous whistleblower. In his data the yearly number of hospitalizations for myocarditis was higher than the number of hospitalizations for heart attack even in the years before COVID (even though in reality hospitalization for heart attack is much more common). His data is supposed to have only included the region of Wellington which accounts for about 10% of the total population of New Zealand, but his data still had about 700 to 900 stillbirths per year:
However according to Statistics New Zealand, there have been only about 300-400 recorded stillbirths per year in the entire New Zealand since 2018. [https://infoshare.stats.govt.nz/ViewTable.aspx?pxID=37ba9dc1-91dd-4470-a605-060ded2c70d3] There was a slight increase in stillbirths in 2022, but it might have been due to random variation since the number of stillbirths was still well within the 95% prediction interval. So the official data for stillbirths is also not consistent with Diane's claim that there was a dramatic increase in stillbirths after the vaccine rollout:
t=fread("http://sars2.net/f/nzstillbirth.csv")[year>=2000] t=cbind(t,predict(lm(stillbirths~year,t[year<2020]),t,interval="prediction",level=.95)) leg=c("Rate per 100,000","2000-2019 linear trend","95% PI") col=c("black","#0000ff","#8888ff") p=t[,.(x=year,y=c(stillbirths,fit),z=factor(rep(1:2,each=.N),,c("Stillbirths","2000-2019 linear trend")))] xstart=2000;xend=2023;xbreak=seq(xstart,xend,2) ylim=c(0,max(t[,c(stillbirths,upr)]));ybreak=pretty(ylim,7) color=c("black","#3333ff");lab="95% prediction interval" ggplot(p)+ geom_ribbon(data=t,aes(x=year,ymin=lwr,ymax=upr,fill=lab),color=color[2],alpha=.2,linewidth=.3)+ geom_line(data=p[!(z%like%"linear"&x>=2020)],aes(x,y,color=z),linewidth=.6)+ geom_line(data=t[year>=2019],aes(x=year,y=fit),color=color[2],linetype="42",linewidth=.6)+ geom_point(aes(x,y,color=z,alpha=z),stroke=0,size=1.5)+ labs(title="Yearly stillbirths in New Zealand",x=NULL,y=NULL)+ scale_x_continuous(limits=c(xstart-.5,xend+.5),breaks=xbreak)+ scale_y_continuous(limits=ylim,breaks=ybreak)+ coord_cartesian(clip="off",expand=F)+ scale_color_manual(values=color)+ scale_fill_manual(values="#3333ff")+ scale_alpha_manual(values=c(1,0,0))+ theme(axis.text=element_text(size=11,color="black"), axis.text.x=element_text(margin=margin(3)), axis.ticks=element_line(linewidth=.4,color="black"), axis.ticks.length=unit(3,"pt"), axis.title=element_text(size=8), legend.background=element_blank(), legend.box.spacing=unit(0,"pt"), legend.key=element_blank(), legend.key.height=unit(13,"pt"), legend.key.width=unit(25,"pt"), legend.position="top", legend.justification="left", legend.spacing.x=unit(2,"pt"), legend.margin=margin(,,6), legend.text=element_text(size=11,vjust=.5), legend.title=element_blank(), panel.background=element_blank(), panel.border=element_rect(fill=NA,linewidth=.4), plot.margin=margin(5,5,5,5), plot.title=element_text(size=11.3,face=2,margin=margin(2,,4))) ggsave("1.png",width=6,height=3.5,dpi=300*4)
In 2024 Steve Kirsch did a video with Tom Haviland and Richard Hirschman, which also featured two embalmers named Lorin Ware and Bill who I haven't seen interviewed elsewhere. [https://rumble.com/v4calhh-vsrf-live-113-embalmer-data-revealed.html]
Bill said this about the clots: "Prior to this - I mean, I've been an embalmer over 30 years - I had never ever seen this - prior to, I'm gonna say July or August of 2021." [time 31:12] Kirsch also asked Lorin Ware "And you started seeing them in mid-2021?" But she answered "Yes sir", and then Kirsch asked: "Was it like a light switch turning on, or did it happen pretty gradually?" And she answered that "It was like a light switch turning on." [time 26:00] But if embalmers started suddenly seeing the clots in mid-2021 then how come no-one was speaking out about the clots until January 2022?
At time 1:03:11 Kirsch asked Bill: "What percentage of the cases that you embalmed are - do you believe are due to, uh - we're killed by the vaccine?" And Bill replied: "I would say over 90%." And Kirsch said: "Wow. Wow. Ok. That's a showstopper." And a bit later Kirsch asked: "Um, so, so Bill, the 90%: how confident are you?" [1:05:21] And Bill answered "100%" And Kirsch asked "100% confident?" And Bill replied "I am. I can, I guarantee you, I can show you every single person that's been vaccinated."
But Bill was a trade embalmer, so how would he even know the vaccination status of the people he embalmed, let alone their cause of death? He said that he worked with multiple funeral homes within a 60-mile area, so did he ask the staff at all the funeral homes to find out the vaccination status and cause of death of the people he embalmed? Was the staff really willing to bother the family members to ask them questions that a funeral home would not normally need to ask? And were they able to find the cause of death with enough certainty that Bill could be 100% sure that 90% or more of the deaths were due to the vaccine? Or was he just sure about it because he saw calamari clots in the bodies he embalmed and he assumed that people with calamari clots died due to a vaccine?
Later during the same interview, Hirschman said: "I don't get the vaccine status because I'm the trade embalmer. Whether the funeral director wants to ask the family is up to them. We had one recently - there's one funeral director I know and an emembalmer - she was pretty blunt you know she just asked the family. And the family asked her 'Was that necessary to ask for the death certificate?' And she says, 'No, I was just was curious.'" [1:57:36] Hirschman's explanation seems reasonable, because the family members would indeed be asking why they need to tell the funeral home about the vaccination status or death certificate of the deceased person.
I can think of 5 or 6 people who have provided first-hand testimony that they have seen calamari clots in the body of a living person:
A bit after Philip McMillan was contacted by his cath lab whistleblower, Tom Haviland started to say that he had been contacted by another cath lab whistleblower, but I didn't find first-hand testimony by Haviland's whistleblower anywhere. John O'Looney has also posted photos and videos of clots he claims to have received from an endovascular surgeon, but I didn't find the surgeon saying himself he had seen the clots anywhere, so I didn't include him on this list.
The earliest person I have found who claims to have seen a calamari clot in a living person is Leunis van Rooyen, who was interviewed by Jane Ruby in September 2022. [https://rumble.com/v1kcwtl-live-7pm-white-clots-pulled-from-the-living.html] Jane Ruby said van Rooyen was a member of a team of surgeons who had removed a calamari clot from the leg of a living person. But he is an alternative medical practicioner whose PhD degree is in natural medicine, so he doesn't seem like someone who would be performing surgery. [https://tailorblend.co.za/Web/Practitioner/Details/6620]
When Jane Ruby asked van Rooyen about snake venom, he said that COVID vaccines induce the human body to produce toxic proteins similar to how snakes produce snake venom: "What happens is that the gain of function genetic therapy causes the body to produce proteins which would be toxic to the body. So I try and imagine for myself being born with some type of a function similar to having glands like a snake, and then these glands produce the protein. So in this case it's just through the metabolic process. So I'm born then with a protein that's - like snake poison is protein, if a spider bites is it's a protein, the same with the most toxic animal we know of - or it's a snail in the sea - and that protein is deadly. So I'm born with this protein produced in my own body by myself to toxify myself. And this is not good at all. Besides this injection, this jab also - professor Dr. Andreas Noack made mention of the graphene hydroxide, which we would like to investigate from the samples we've got from these so-called blood clots or nylon ropes - I would like to subject it now to a mass spectrometer to see if we can see these graphene hydroxide." [20:41] (Where by "nylon ropes" he meant calamari clots.)
Next Leunis van Rooyen showed a microscope images taken by Zandre Botha, who is another alternative medical practicioner from South Africa like Leunis van Rooyen. In 2021 Zandre Botha showed Stew Peters photos of self-assembling discs she found in a vaccine vial, and in 2022 she showed Jane Ruby microscope photos of snake venom peptides in COVID vaccines. [https://rumble.com/v24zioe-blood-doctor-reveals-horrific-findings-dr.-zandre-botha-and-stew-peters-10-.html, https://rumble.com/v11zh8o-first-pictures-and-videos-of-snake-venom-peptides-in-bioweapon-shots.html]
First van Rooyen showed the photo below and said "From this nylon rope I received, I requested that Dr. Zandre to take me into a laboratory and we would look and their microscope at some cells from this. We saw the cells being damaged and typically what I would expect a cell would look like being poisoned from from snake": [27:24]
He also showed these photos which supposedly showed Zandre Botha's blood cells before and after exposure to a COVID vaccine:
Next van Rooyen said that COVID vaccines will induce the production of amyloid proteins which might lead to a zombie apocalypse.
In February 2024 Philip McMillan claimed that he had been contacted by an anonymous whistleblower who worked at a catherization laboratory, where he had removed calamari clots from the bodies of living people.
McMillan did an audio-only interview with the whistleblower, who said: "But this new white clot issue - which I compare them to calamari or rubber bands, very strong rubber bands that cannot be pulled apart - this phenomenon has started in, um, late 2021. And we have pictures as early as early 2022." [https://philipmcmillan.substack.com/p/are-the-embalmers-clots-occurring, time 7:07] So it seems unusual how he said he only started to see the clots in late 2021, even though the morticians usually say they started seeing the clots in mid-2021 or early 2021.
The whistleblower said: "We have about 20 on staff, nurses, anesthesiologists, vascular surgeons, radiologists, and, uh, cardiologists - have all witnessed this." [7:58] But if there's several types of specialists who work at cath labs who are seeing the clots, then why are there so few people speaking out about the clots?
McMillan's video also featured his sidekick Dr. Shankara Chetty, who said: "When we looked at this initially with Mr. Hirschman, I think it was, I was considering whether this is something to do with the hydrogel that's used - hydrogels have been used as tissue clues, that kind of thing for a long time. And I think we need to look at the research around hydrogels and how they interact with other things. Because this - this is not - this is not natural. So it's got something to do with, whatever, I mean, or whatever the nanotechnology that's being used - or the hydrogels, the lipid nanotechnology." [21:52] Karen Kingston and David Nixon also say that the calamari clots are made up of hydrogel, and Sasha Latypova told Jane Ruby that hydrogel is probably incorporated into the clots. [https://karenkingston.substack.com/p/millions-of-self-assembling-nanotech, https://davidnixon.substack.com/p/hydrogel-gelplastic-and-rubbery-clots, https://www.bitchute.com/video/6wSCNCHm1dUa/ (time 40:45)]
At time 16:12 McMillan showed the photo below and asked: "And was this one of the very stretchy rubbery-like clots?" And the whistleblower said "Yes sir." But the clot is not even white (even though I don't know if it's supposed to turn white if it's washed of blood):
At time 17:15 the whistleblower showed this photo and said: "That is a lower-leg extremity DVT blood clot. But the reason why they might appear normal - although this one doesn't, the last one did - it's pulled directly from the patient - which still is coated in blood." So his explanation for why the clots are not white does indeed seem to be that the clots are covered in blood:
Next the whistleblower showed the photo of a pulmonary embolism below. Then McMillan said: "Now saddle PE's, I mean, they do occur. So it's not as if they don't occur. What about this would have made you concerned?" And the whistleblower asked: "As far as what, can you repeat?" And McMillan said: "So was it just a bigger clot or is it actually seeing multiple saddle PE's far more than you would normally?" And the whistleblower answered: "Yes. We have a big increase on our numbers when it comes to saddle PE. We used to maybe get one every couple of months. Now we're getting a couple every week." So it's not even clear if the whistleblower was saying that the clot he showed was a new type of white clot or not, or if he just it was a regular clot but what made it unusual was that he was now seeing regular clots more often than earlier:
The whistleblower's photo of a pulmonary embolism clot doesn't look too different from regular pulmonary embolism clots:
The whistleblower also showed the next clot, but it looks the color of a normal blood clot, and it doesn't really look like it would turn white even if it was washed of blood:
When McMillan showed the clot below, he circled the part I highlighted with his mouse asked "Now this again was the white fibrous bit." And the whistleblower replied "Yes sir." The clot also has a couple of other similar lighter bits, but all of the lighter parts are very small compared to the clots Hirschman has shown. The middle and right clots also look very wide, because they seem to be about 3 inches at the widest part:
The whistleblower also showed a couple of other clots, but all of them just looked like regular red clots. Couldn't he at least have shown photos of the clots before and after washing them of blood? Then it would've been clearer if the clots were actually white or not.
Greg Harrison claimed that Matt Shelton had seen calamari clots in a living person: [https://x.com/Greg21143362/status/1910659753061007514]
Here John O'Looney wrote that vaccines contain graphene razor blades that are activated by 5G. When someone asked him if we need any more scary stories, Matt Shelton replied "Well apparently we do Jennine. The white clots are real enough. I've seen and stretched them. Blood looks terrible now." [https://x.com/sussdoc/status/1847715403134619667]
Shelton also replied to another user in the same thread that "I've seen his and others' and my own clots. Stretched them myself." [https://x.com/sussdoc/status/1847715403134619667]
However when Shelton said he had stretched his own clots, it as not clear if he meant clots he had removed himself from a living person or something else. So I have not found any place where Shelton had provided unambiguous first-hand testimony that he had seen the clots in a living person. When I asked about it from Matt Shelton and Greg Harrison, I didn't get any answer.
In 2022 Matt Shelton did a video with Maria Zeee where he claimed that vaccines contained nanotechnology and graphene oxide (and as evidence he presented images of nanotechnology that were taken with a light microscope): [https://rumble.com/vy0fic-dr.-shelton-and-sue-grey-evidence-of-nanotechnology-and-graphene-oxide-in-c.html]
This was one of the microscope images that Matt Shelton showed to Maria Zeee. He said he didn't know what the image showed but he said it was not a natural structure, and he said "The rounding on the corners, you know, this is precision, um, there's some sort of an algorithm to produce them": [41:25]
At the start of the video Shelton said that his team started researching graphene and nanobots after they had been contacted by a patient who had become magnetized after vaccination. And then he mentioned that his work was following in the footsteps of La Quinta Columna and people in Arne Burkhardt's pathology conference: [10:04]
Well, it was actually in response to having some patients contact us who found that they had become magnetized after their vaccination. So we had a look and met some people who, you know, indeed did seem to show some magnetism. And we - so we did a science report - we did a little research project, and came across La Quinta Columna and the work that they had done. And in fact, Dr. Campra had already done his very high-level science report where he had shown the presence of graphene-based, you know, microstructures, you know - the word nano was used, but now I refers to, you know, incredibly small scale, you know, you're almost down at the sort of molecular level - whereas he and his team were seeing things down a microscope. So as part of the report to the government on people's magnetism concerns, we included what we'd found around the graphene contamination and apparent chips and, you know, electronic circuitry also it seemed.
And shortly after that, a German team of pathologists had a very powerful conference that they recorded and uploaded. And that's well worth everybody looking at. And that was in two parts. In the first half, they were describing the post-mortem findings and people who died after vaccination. And they were reporting things that they'd never seen in their whole careers. And in the second half, they were talking about particles that had been found on microscopy of the vaccine itself. So we first told government at the end of September last year that this stuff was emerging.
He was talking about Arne Burkhardt's so-called "pathology conference" which was held in the offices of Burkhardt's private practice in September 2021. Burkhardt's pathology conference was divided into two halves, where during the first half Burkhardt showed his pathology slides, but during the second half other people showed microscope images of vaccines and the blood of vaccinated people. I believe Burkhardt never published any proper written report about his findings, but he just published videos to a mass audience where he showed scary microscope images, just like what the nanobot and graphene crew was doing. People in Burkhardt's conference were saying that vaccines contained minirobots, graphene oxide, and a parasite called Tryponasoma cruzi, and that the blood of a vaccinated person contained a synthetic fiber that may have been a Morgellons fiber. [turbo.html] Burkhardt's conference featured Viviane Fischer and it was presented as a press conference similar to the press conference larping operations of Reiner Füllmich, so at first I thought the conference was organized by Füllmich, but I didn't find Füllmich being involved with the conference. (And Burkhardt's conference is also notable because it's where the term "turbo cancer" was first introduced. The term was specifically used the lawyer Elmar Becker, who was a member of an organization called Lawyers for Enlightenment that was cofounded by Füllmich. Becker conveyed an anecdote about turbo cancer from the German alternative medical practicioner Ute Krüger, who claims to have access to "energy field technology" so that she is able to detect imbalances in the energy field which is the "non-material part through which the body and soul communicate".)
Matt Shelton has also been interviewed by Phillip McMillan. So far Shelton is possibly one of 4 or 5 people I have found who have personally claimed that they have seen calamari clots in a living person, but all except one of the people have been interviewed by McMillan. During the interview with Shelton, McMillan said: "Once you speak about embalmers' clots, you get put into a category of a conspiracy theorist. Now the question is, if you take that one step further, and you go into the category of vaccine nanobots, you are therefore an ultra conspiracy theorist. Now, I am saying this because I just recently did a video on this paper that was produced by two people - one in South Korea one in Japan - about changes or things in the vaccine." [https://www.youtube.com/watch?v=FFJwkSaIVHE&start=37m12s] Then McMillan and Shelton discussed the nanobot paper by Youngmi Lee and Daniel Broudy in the journal IJVTPR, but they presented the paper in a positive light.
Shelton said this about Daniel Broudy: "I know Daniel, and he actually has a very important, um, professional background, um, that's that's far more relevant than than his linguistics. But he is as a you know a goldmine on the way that language is used, um to propagandize, um you know, and force ideas and arguments onto people. And I think that it was very important that somebody like him had a kind of an oversight into you know the structure of the paper." [44:44] I don't know if by Broudy's relevant background he meant Broudy's background in military intelligence. And anyway it's really reassuring how Broudy is an expert on how language is used to propagandize and force ideas and arguments onto people.
In 2022 the journal IJVTPR published a paper about nanobots by Daniel Broudy and Valerie Kyrie, where Broudy and Kyrie cited a video by Matt Shelton about nanobots in COVID vaccines. [https://ijvtpr.com/index.php/IJVTPR/article/view/49] Valerie Kyrie's bio says that she works "in the areas of political psychology, the psychology of atrocity, and psychological operations / perception management" and that "her doctorate in psychology focused on the topic of reality-perception and its manipulation".
Shelton is a cofounder of NZDSOS (New Zealand Doctors Speaking Out with Science), which posted a tweet that promoted An Unholy Triad. [https://x.com/nzdsos/status/1894285548929650831] Shelton was credited as one of the three executive producers of An Unholy Triad along with Brenton Faithfull and Wayne Crouch's cohost lady Lisa Johnston. And he was also credited as a member of the "scientific research and advisory team" of the videos along with Greg Harrison, Bruce Rapley, Daniel Santiago, Andrew Zywiec, and Gerry Brady.
Shelton also promoted An Unholy Triad on Twitter:
Matt Shelton claimed that vaccinated people were magnetic. But an article about the clots by NZDSOS said this about the clots: "But perhaps, like the temporary magnetism in some vaccinated, and the self assembling microtech - supported by a considerable scientific literature - these topics seem too outlandish for many people to contemplate." https://nzdsos.com/2024/02/20/rubbery-clots-campbell/] The article also said that the clots were "gel/plastic" according to David Nixon: "Another term gaining momentum is gel/plastic, as coined by NZDSOS member David Nixon who is doing very important work at his [microscopy substack."
The NZDSOS member David Nixon has claimed that he has found microchips and robot arms in vaccines under a microscope. During ane interview he did with Maria Zeee, Zeee said: "I want to ask you, Dr. Nixon, because it looks like little robot arms, even." [https://zeeemedia.com/interview/world-first-robotic-arms-assembling-via-nanotech-inside-covid-19-vaccines-filmed-in-real-time-dr-nixon/, time 8:52] Then Nixon circled the part of the video below where I added the red circle, and he said: "This is - this - you look at the way the levers are working in this - but, you know that - you've got triangles, you've got levers, you've got pinchers. […] It even falls up on itself, goes up to get the leverage. […] It creates some sort of a propulsion system, I mean, you look at the rotation on that."
In February 2025 Philip McMillan published an interview with Dr. Azzard Comrie from Jamaica, who claims he is seeing the clots in living people. [https://philipmcmillan.substack.com/p/doctor-speaks-out-about-shocking]
At the start of the video McMillan said: "So over the period of time we have been asking questions about has anyone else seen these clots, has anyone else stepped forward? And the fact that nobody has come forward seems to give the impression that this is not occurring, or if it is it's only random and not too significant." (And that's in fact the impression you get, because there seem to be only a handful of people who claim to have seen the clots, and there's even fewer people who claim to have seen the clots in living people. Actually I can think of only 4 or 5 people who have personally testified that they have seen the clots in living people, but all except one of them have been interviewed by McMillan.)
And after that McMillan said that Azzard Comrie was his friend from high school: "This is someone that I know - and therefore he has independently however reached out to me - so I have known him for many many years from my high school days, because we were at a similar school. And he's also a practicing doctor. But I haven't been in contact with him for a long time. And so him reaching out to me at this point is representative of the fact that he wants to raise awareness of this, not necessarily because of our direct connection."
But what are the odds that one of the few people who claims to have seen the clots in a living person happened to be a childhood friend of the same guy who was contacted by the anonymous cath lab whistleblower?
In 2025 Wayne Crouch from Australian National Review published a series of documentary videos titled "An Unholy Triad: The Birth of a Plague". The videos were narrated by an AI voice, they featured a lot of AI-generated imagery, and even the script sounded like it was generated by AI, so I don't know if the videos were made with some AI video generation software.
The credits of the videos mention Wayne Crouch, Lisa Johnston, Brenton Faithfull, Matt Shelton, Greg Harrison, Bruce Rapley, Daniel Santiago, Andrew Zywiec, Gerry Brady, Matt Shelton, Todd Callender, Richard Hirschman, John O'Looney, and Brenton Faithfull: [https://rumble.com/v6paaoo-an-unholy-triad-the-birth-of-a-plague-episode-01.html?start=454]
Wayne Crouch is the "head reporter" at Australian National Review, which looks like an Aussie version of the Stew Peters Network. The front page of ANR's website featured two interviews of Stew Peters: [https://anr.news]
Wayne Crouch has a BitChute channel with only 15 subscribers. Many of his videos weren't even uploaded on any other site except ANR's own social media called Truthbook.Social. But somehow he still managed to book interviews with people like Robert Malone, David Icke, and Errol Musk: [https://www.bitchute.com/channel/Bbk5AP5d]
The main theme of the Unholy Triad videos was how Crouch's research team had supposedly found new mysterious ORFs in the genome of SARS-CoV-2. The first episode of the series said: "Direct evidence, lab records, internal PLA documents, and intercepted communications confirms China engineered three ORFs critical to SARS-CoV-2. ORF11: Documents from the early 2000s detail a gene enhancing viral entry into human cells, tested in bat coronaviruses at WIV to boost infectivity. ORF19: Research logs from 1999 to 2005 describe a sequence amplifying viral replication designed to accelerate spread uncovered in PLA virology studies. ORF29: Military reports from 2003 to 2008 outline a gene modulating host inflammatory responses intended to exacerbate disease severity trace to WIV experiments." [https://rumble.com/v6paaoo-an-unholy-triad-the-birth-of-a-plague-episode-01.html?start=309] But none of the purported "research logs" or "military reports" were actually shown in the video series.
The fifth episode of An Unholy Triad said that ORF19 and ORF29 are responsible for the formation of clots: "The ORFs are the masterminds, ranked by their deadly impact. The ORF19, fueled by phosphorus, locks fibrin and actin into indestructible amyloid-like clots, the backbone of this nightmare. Second, ORF29 with tin cements them rigid ensuring they resist all breakdown. Third, ORF8 twists immune evasion by blinding T-cells, letting clots thrive unchecked. Fourth, ORF3a ignites inflammation and tissue chaos, amplifying clot formation. Fifth, ORF11 blocks cellular cleanup prolonging the damage. And then in sixth place is ORF6: it cripples interference, weakening early defenses." [https://rumble.com/v6qrijq-an-unholy-triad-the-birth-of-a-plague-episode-05.html?start=205] Another episode of An Unholy Triad said: "We've ranked the ORF: ORF6 is quiet sabotage, ORF11 is cleanup block, ORF3a is chaos, ORF8 stealth, ORF29 cement, ORF19 slaughter. A kill chain forged in the abyss." [https://rumble.com/v6r40im-an-unholy-triad-the-birth-of-a-plague-season-02-episode-01.html?start=130]
The regular ORFs of SARS-CoV-2 only go up to ORF10, but I don't know if ORF19 and ORF29 are supposed to be a nested ORFs inside the spike protein or something. Later parts of An Unholy Triad claimed that the same ORFs were included in both the vaccines and the virus, which seems to suggest that the mystery ORFs are nested ORFs within the spike protein, since the most common vaccine types in western countries only include the spike protein (even though Sinopharm and Sinovac vaccines include the whole virus).
Wayne Crouch wrote that the mystery ORFs were deciphered by "our chemist", which probaby refers to Greg Harrison who is a chemist, and who is a member of the Solution of Scientists group that also includes Wayne Crouch: [https://puremediaaustralia.org/f/global-conspiracy-exposed-unveiling-the-ultimate-bioweapon]
The Revelation
Our brilliant Chemist, part of a scientific research team we call "A Solution Of Scientist's".
Has unearthed evidence suggesting that the Soviet Union (now Russia), the United States, and China (PLA) have collaborated in a dark trinity to engineer what can only be described as the ultimate bioweapon.
This weapon, disguised within the fabric of a global health crisis, leverages the genetic capabilities of viruses, particularly through the modification of viral Open Reading Frames (ORFs), to achieve its deadly purpose.
The Evidence:
Historical Bioweapon Research: Our investigation reveals a lineage from the Soviet-era chemical clotting agents and fibrinolysis inhibitors, through U.S. advancements in immune modulation, to the Chinese mastery in synthetic biology and gain-of-function research.
Each nation's contribution has built upon the previous, culminating in a sophisticated bioweapon.
Modified ORFs: Our Chemist's research has deciphered documents written in what we now understand to be bioweapon nomenclature, a language reserved for those with clearance in bioweapon programs.
These documents detail modifications to ORFs like ORF10, ORF11, and ORF19, which are not just coincidental in their effects but engineered for specific, lethal outcomes including persistent clotting, immune evasion, and systemic amyloidosis.
As an example of the secret bioweaponeer code that was deciphered by Greg Harrison, here "Hetnody Ane Uadeeanchounsylnfrtn" is code for "Cytokine-Anchored Systemic Inflammation": [https://x.com/Greg21143362/status/1888539927929037124]
I think Harrison was seriously trying to pass off the AI-generated images shown below as images that employed a secret code used by Chinese bioweaponeers. He posted the images in a Twitter thread where he showed screenshots of a file called Chinese_Dialect_ORF_Maps_ALL-comparisons_9_1_25.doc
: [https://x.com/Greg21143362/status/1888539927929037124]
Speaking of prions…ORF-19 appear to be the front-runner…and yes, AI can read & speak ORF…;
![]()
Being able to read & speak ORF is highly revealing….
![]()
AI loves ORF….makes everything become clear….
![]()
Greg Harrison also tried to pass the image below off as a real plasmid map, where the caption says: "The plasmid map shown here, with detailed annotations of ORF-11, ORF-19, and other spike protein modifications, suggests a high-level bioengineering analysis, likely produced by a research institution specializing in synthetic biology, virology, or classified military bioweapon research." [https://x.com/Greg21143362/status/1891241646051705287/photo/1]
The next image posted by Greg Harrison said that there were "ORF-19 components dispersed throughout the SARS-CoV-2 genome (as depicted in the provided map)", and it included an image of the same fake plasmid map where there were 4 different labels for ORF19: [https://x.com/Greg21143362/status/1888535914789454191/photo/1]
The hoax about ORF11 and ORF19 seems to have been inspired by a Twitter thread from 2023 by Patent_SUN, who wrote about analysis by the Japanese Twitter user mbi92710920. When mbi92710920 ran ORFfinder on the Pfizer plasmid sequence that was uploaded to GenBank by Kevin McKernan, the ORF for the spike protein was labeled ORF11, and the long ORF on the reverse strand that spans almost the entire length of the spike protein was labeled ORF19: [https://x.com/Patent_SUN/status/1699619448909713661]
Patent_SUN also posted this plasmid map for the ORFs (where there's just a single ORF19 on the reverse strand and not multiple different "ORF-19 components" like in Greg Harrison's AI hallucination):
You can try to run ORFfinder yourself here: https://www.ncbi.nlm.nih.gov/orffinder/. If you enter "OR134577" to the big text field and click "Submit", the ORF of the spike protein is numbered ORF11 and the long reverse ORF is numbered ORF19:
The longest ORF on the reverse strand of McKernan's Pfizer sequence is 1252 amino acids long (if you don't include alternative start codons): [https://www.ncbi.nlm.nih.gov/nuccore/OR134577]
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta&id=OR134577'>pfizerspike.fa $ r=$(seqkit seq -rp pfizerspike.fa|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit seq -gm4|seqkit stat file format type num_seqs sum_len min_len avg_len max_len - FASTA Protein 54 2,858 4 52.9 1,252
The long reverse ORF exists only in the vaccine but not the virus, because the ORF was produced by codon optimization which coincidentally removed stop codons from the reverse strand. In the reference genome of SARS-CoV-2, the longest ORF on the reverse strand of the spike protein is only 82 amino acids long:
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_na&id=MN908947'|seqkit grep -nrp gene=S>sars2spike.na $ r=$(seqkit seq -rp sars2spike.na|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit seq -gm4|seqkit stat file format type num_seqs sum_len min_len avg_len max_len - FASTA Protein 35 642 4 18.3 82
Patent_SUN's thread said that there are 23 prion motifs in ORF19, which meant that the reverse ORF has 23 matches to the motif GXXXG
:
$ r=$(seqkit seq -rp pfizerspike.fa|seqkit seq -s);for x in $r ${r:1} ${r:2};do sed 's/.../& /g'<<<$x|grep -Po 'ATG.*?(?=(TAA|TAG|TGA))'|tr -d \ ;done|awk '{print">"NR}1'|seqkit translate|seqkit sort -lr|seqkit head -n1|seqkit locate -rPpG...G|sed 1d|wc -l 23
So therefore Greg Harrison's crew claims that ORF19 is the "most dangerous" ORF because it has the highest number of matches to GXXXG
: [https://x.com/CoyoteSanctuary/status/1904011361538957764]
But then is ORF1ab even more dangerous than ORF19? ORF1ab has 24 matches to the GXXXG
motif, which is even higher than 23 matches in the reverse ORF in the Pfizer plasmid:
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=NC_045512'>sars2.aa $ seqkit locate -PrpG...G sars2.aa|awk 'NR==FNR{a[$1]++;next}{print $1 in a?a[$1]:0,$0}' - <(seqkit seq -n sars2.aa)|sed 's/ .*protein=\([^] ]*\).*/ \1/' 24 ORF1ab 15 ORF1a 7 surface 0 ORF3a 0 envelope 1 membrane 0 ORF6 1 ORF7a 0 ORF7b 0 ORF8 5 nucleocapsid 0 ORF10
Greg Harrison posted the table below where he now has mystery ORFs going up to ORF100: [https://x.com/Greg21143362/status/1906271151120097528/photo/2]
But the data in the table looks fake because the Q/N content and R/K content values are all divisible by 5. For example ORF85 is shown to have 15% Q/N content. But the length of ORF85 is 28 aa, and 4/28
is about 0.143 and 5/28
is about 0.179, so neither is 15% when rounded to the nearest integer. There is no integer you can divide by 28 that produces a percentage of 15% when rounded to the nearest integer.
Greg's table shows that ORF10 is 38 aa long, which matches the real length of ORF10 in Wuhan-Hu-1 if you don't count the stop codon. But Greg's fake ORF10 has 10% Q/N content and 20% R/K content, even though in the real ORF10 in Wuhan-Hu-1 there's 1 Q and 5 N so there's about 16% Q/N content, and there's 2 R and 0 K so there's about 5% R/K content:
$ curl 'https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=nuccore&rettype=fasta_cds_aa&id=NC_045512'|seqkit grep -nrp ORF10 >lcl|NC_045512.2_prot_YP_009725255.1_12 [gene=ORF10] [locus_tag=GU280_gp11] [db_xref=GeneID:43740576] [protein=ORF10 protein] [protein_id=YP_009725255.1] [location=29558..29674] [gbkey=CDS] MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
Greg's table also shows that ORF29 is 60 aa long and it has 50% Q/N content. There's a total of 59,448 possible 60 aa segments of Wuhan-Hu-1 on all 3 frames of both strands. But the highest number of Q and N residues in any of the segments is 16, and 16/60
is only 27%:
$ (seqkit replace -p'.*' -rforward sars2.fa;seqkit seq -rp sars2.fa|seqkit replace -p'.*' -rreverse)|seqkit sliding -W180 -s1)seqkit translate|seqkit fx2tab|awk '{x=$2;print gsub(/[QN]/,"",x),$1,$2}'|sort -rn|head [WARN] flag -t (--seq-type) (DNA/RNA) is recommended for computing complement sequences 16 reverse_sliding:9317-9496 Q*SL*QP*KLQINLGILLFQQNHQVINQ*QNTHT*MNLFAHLL*NSF*LYCP*E*NLLIQ 16 reverse_sliding:8894-9073 QLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQLM 16 reverse_sliding:8891-9070 VQLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQL 16 reverse_sliding:8888-9067 YVQLHNHQSKLNLHQRQSH*DLNRQAAYP*ATTVLKQLYLVQLLYQNQHQNV*LSYYRVQ 16 reverse_sliding:15020-15199 NQSTYQQLQLQIVVV*YHTLLVDYNDSSHNR**QHYHPEQRRSVLIQQNFLP*RNP*TQQ 16 reverse_sliding:15017-15196 NNQSTYQQLQLQIVVV*YHTLLVDYNDSSHNR**QHYHPEQRRSVLIQQNFLP*RNP*TQ 16 forward_sliding:24299-24478 QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA 16 forward_sliding:24296-24475 TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFG 16 forward_sliding:24293-24472 VTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNF 16 forward_sliding:24290-24469 GVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSN
Out of the 8 ORFs in Greg's table, ORF10 has the same length as the real ORF10 of Wuhan-Hu-1, but 5 out of the 7 imaginary ORFs have a length that is divisible by 5. If you pick 7 random integers in the range of 22 to 75 so that repetitions are allowed, the likelihood that 5 or more of the integers are divisible by 5 is about 0.5%: v=22:75;sum(dbinom(5:7,7,sum(v%%5==0)/length(v)))
.
I gave this prompt to Perplexity: "generate table of imaginary ORFs 10, 11, 19, 29, 85, 45, 60, and 100 of SARS-CoV-2 with length ranging from 22 to 75 aa, with columns 'Length (aa)', 'Q/N Content (%)', 'R/K Content (%)', 'Disorder Score (IUPred avg)', 'Aggregation Score (TANGO)', and 'Prion-like domain score (PLAAC)'". 7 out of 8 ORFs had a length that was divisible by 5. And all of the Q/N content and R/K content percentages were divisible by either 5 or 2:
Mysterious black balls have been found on beaches in Australia. [https://www.theguardian.com/australia-news/2024/nov/09/nsw-regulator-chose-to-reveal-content-of-sydneys-mystery-beach-balls-on-day-of-us-election] Greg Harrison claimed that the balls were formed due to misfolded spike proteins which ended up in sea water, because he said that "ORF-driven spike misfolding" leads to a production of amyloid protein, which ends end up in wastewater through shedding, and then after the wastewater runs off into the sea, the amyloid proteins congregate into black balls with a diameter of several centimeters: [https://x.com/Greg21143362/status/1906598416341192741/photo/2]
Greg's theory was summarized by this graphic, which shows how his fake ORFs ORF11 and ORF19 lead to "amyloid-prionduction":
Wayne Crouch also posted this tweet about how the black marine amyloid balls will kill everyone: [https://x.com/WayneC50256258/status/1906627345378844868]
In March 2025 a Rumble channel called Flashlights published an interview of Richard Hirschman. During the interview he talked about the mystery ORFs: "And this kind of stuff right here you're going to probably start hearing in the future about - these ORFs, basically what I understand here is these reading frames are manufactured - there's patents apparently on many of them, and some of them we can't even find all of them. But we've got amino sequencings and all that stuff. Basically it's - it seems like it's - this whole thing has been a bioweapon. The whole thing sounds like it's been a bioweapon. And there's been many people - like Karen Kingston's been talking about bioweapons - we all were told that this all just happened in 2019. No this is something they've been working - they've been working on this kind of stuff for a long time." [https://rumble.com/v6qheaq-white-clots-in-the-dead-and-living-hirschmans-insights-from-4-years-of-post.html?start=8940] And a bit later he said: "On this chart here - which, you know, I didn't create that chart - but that ORF says - this is the spike ORF - ORF11, 7 prion motifs. And on it says mystery ORF19, 23 prion motifs." [2:40:01]
But to Hirschman's credit, at least he said that ORF11 was the spike ORF, and he showed a real plasmid map of the Pfizer vaccine and not one of Greg's AI-hallucinated plasmid maps. Greg later claimed that ORF11 was 35 aa long. [https://x.com/Greg21143362/status/1906271151120097528] But you could easily see from Hirschman's image that ORF11 was much longer than 35 aa:
In February 2025 Philip McMillan posted a Substack post where he promoted the first part of the Unholy Triad series. He said that the authors of the video had access to 6,000 pages of secret documents that they were going to release as a dead man's switch in the event that any of the authors are silenced. McMillan claimed to have personally seen some of the secret documents which described ORF11 and ORF19: [https://philipmcmillan.substack.com/p/covid-secrets-theyre-hiding-from]
I was woken up at 4 a.m. this morning with information so shocking that it has left me reeling. Over the past few years, I have had the privilege of speaking with some of the world's leading scientists, those who refuse to stop investigating the depths of COVID-19's origins and impact. But today's revelation is different. It is worse than even I had imagined.
For those who have followed my work, you know that I have always been driven by one question: What if we were never told the whole story? Now, thanks to a group of relentless scientists, we have 6,000 pages of documents that lay bare the full pandemic timeline, from inception to global rollout. And what they reveal is more than just negligence or incompetence; it suggests a deliberate obfuscation of critical facts.
[…]
Within these documents, there is one section that immediately caught my attention—the reference to modified ORFs (Open Reading Frames) 10, 11, and 19 in the SARS-CoV-2 genome. This seemingly minor genetic detail might hold the key to understanding the virus's impact on human biology, particularly its ability to drive unprecedented clotting mechanisms.
[…]
What makes this discovery even more alarming is the response from authorities. The scientists behind this breakthrough are already facing pressure from powerful institutions. Some have been warned not to publish their findings. Others have been contacted by government officials who want access to the data before it goes public.
Even as I share this with you, precautions are being taken. The lead researchers have secured multiple copies of the documents, and in the event that any of them are silenced, the information will immediately be released worldwide. There is no stopping this truth now.
In March 2025 Philip McMillan livestreamed a video about the fake ORFs where he was reading from a document titled Daniel_Santiago_ORF_relationships_Quantum_Codon_Energetics_12_3_25
. [https://www.youtube.com/watch?v=BVg_aoK2EaM, https://x.com/i/broadcasts/1lPJqMDwNjdJb] I didn't find the document published anywhere, but McMillan showed these pages of the document during the stream:
So Daniel Santiago's document now has mystery ORFs going up to ORF100. And for some reason the ORFs are organized in blocks of about 20 ORFs, where the ORFs within each block similar functions, even though normally ORFs are numbered based on their position in the genome and not so that ORFs with similar functions are given consecutive numbers.
The document McMillan showed was titled Daniel_Santiago_ORF_relationships_Quantum_Codon_Energetics_12_3_25
. "Quantum codon energetics" refers to a nonsensical technobabble theory by Daniel Santiago, which sounds like something out of a paper by Jean-Claude Perez: [https://www.preprints.org/manuscript/202503.0548]
I don't know if Daniel Santiago is supposed to a member of the "Solution of Scientists" group, but he was featured in Maria Zeee's clot panel together with Hirschman, Greg Harrison, and Wayne Crouch, and he has also done other videos with Hirschman and Harrison, and he was credited as a member of the "scientific research and advisory team" of An Unholy Triad.
But anyway if McMillan was for real, he should've realized that the documents about the mystery ORFs were fake. And in fact even if he would've only watched the first part of the Unholy Triad series, he should've realized that the videos were a hoax. But instead he had little negative to say about the ORFs, and he published multiple videos and posts where he promoted the story about the ORFs, so it makes him look like controlled opposition who is deliberately promoting false information.
Therefore it is very telling how it was McMillan out of all people who was contacted by the anonymous cath lab whistleblower, and how McMillan's childhood friend Azzard Comrie is one of the few people who claim to have seen the calamari clots in living people. In the same way that in 2022 early revelations about the clots were presented by Jane Ruby, in 2024 and 2025 news about the clots have often been first broken by McMillan.
Steve Kirsch posted two tweets where he promoted An Unholy Triad: [https://x.com/stkirsch/status/1905489721654165629, https://x.com/stkirsch/status/1907637107239350612]
John O'Looney also promoted An Unholy Triad on Twitter and LinkedIn:
The Unholy Triad videos are so awful that when I wrote this in April 2025, the first part had about 2,000 views on Rumble and the other parts all have less than a thousand views, even though the view counts on Rumble often seem to be inflated, and the videos were promoted by big names in alt media like Steve Kirsch, John O'Looney, and Philip McMillan.
When I tried searching Twitter for the Rumble URL of each episode of An Unholy Triad, I got a total of 36 results, out of which the most results were posted by Greg Harrison (13), a user called max_ev_84 (7), Wayne Crouch (5), and Greg's cheerleader CoyoteSanctuary (5):
Episode | User | Tweets |
---|---|---|
S2E02 | Greg21143362 | 2 |
S2E02 | thanku4speakin1 | 1 |
S2E01 | max_ev_84 | 7 |
S2E01 | CoyoteSanctuary | 5 |
S2E01 | WayneC50256258 | 3 |
S2E01 | Greg21143362 | 3 |
S2E01 | Fredy13_Backup | 1 |
S1E06 | Greg21143362 | 2 |
S1E05 | Greg21143362 | 3 |
S1E04 | Greg21143362 | 3 |
S1E03 | WayneC50256258 | 1 |
S1E03 | AlexGnarcia | 1 |
S1E01 | WayneC50256258 | 1 |
S1E01 | ChakraSeven | 1 |
S1E01 | gemoscatelli | 1 |
S1E01 | Mister__Q | 1 |
(My table above does not include the tweets by Kirsch or O'Looney, because Kirsch quoted Greg's tweets and O'Looney didn't post links to Rumble but to the website of Australian National Review.)
A tweet that promoted An Unholy Triad was also posted by NZDSOS (The New Zealand Doctors Speaking Out with Science). NZDSOS wrote that the videos were based on "thousands of encrypted pages" of documents: [https://x.com/nzdsos/status/1894285548929650831]
This is the first release of a planned series of videos based on a new treasure trove of thousands of encrypted pages provided to a small group of doctors and scientists along with the owners of an online news site, Pure Media Australia.
Now successfully being decrypted, so far the information appears largely public domain already, but puts the focus back on the provenance of the so-called virus responsible for the illness labelled Covid-19.
[…]
The encrypted files contained bioweapons language, and document highly specific sequences, called open reading frames (ORFs), in SARS COV-2.
These ORFs are genetic code that make host cells produce proteins which, amongst other things, can cause severe inflammation and clotting, including the highly abnormal white clots that seem to be an amyloid process in the blood itself (amyloid usually affects specific 'solid' organ systems).
NZDSOS was co-founded by Matt Shelton who was credited as one of the three executive producers of An Unholy Triad and a member of its "scientific research and advisory team". Shelton also posted tweet where he linked to An Unholy Triad. [https://x.com/sussdoc/status/1894296773033664957]
In early 2025 when Greg Harrison and his cohorts were pushing the hoax about the fake ORFs, their biggest cheerleaders on Twitter were users called CoyoteSanctuary and RexesRule/CatsRule2023. Both of them also joined Kevin McCairn's Discord around December 2024 after McCairn had started doing videos with Hirschman and Harrison. Even after I had posted exhaustive evidence on the Discord which clearly showed that Greg's ORFs were a hoax, RexesRule and CoyoteSanctuary kept defending Greg's ORFs, and they just told me that I was crazy or that I was a counterintelligence agent. So I thought they might have been in on the scam, since otherwise their behavior of defending Greg's hoax did not seem reasonable.
When I looked into the Twitter profile of RexesRule, I noticed that her banner image had a seal that said "NAVSECGRUDIV" and "NAVCAMSEASTPAC". When I searched for the image on reverse image search engines, I didn't find any other place where the image was posted with the seal, so she seems to have added the seal herself: [https://x.com/CatsRule2023]
Wikipedia says: [https://en.wikipedia.org/wiki/Naval_Security_Group]
The Naval Security Group (NAVSECGRU) was an organization within the United States Navy, tasked with intelligence gathering and denial of intelligence to adversaries. A large part of this is signals intelligence gathering, cryptology and information assurance. The NAVSECGRU organization was active from March 1935 to September 2005.
In addition to being part of the Navy, NAVSECGRU was also part of the National Security Agency's Central Security Service.
The NAVSECGRU organization was transferred to the Naval Network Warfare Command (NETWARCOM) where its former assets made up the Information Operations Directorate.
"NAVCAMS EASTPAC" is short for "Naval Communication Area Master Station, Eastern Pacific". [https://en.wikipedia.org/wiki/Naval_Computer_and_Telecommunications_Area_Master_Station_Pacific]
I found a thread where RexesRule wrote: "My NAVSECGRU team was the best." [https://x.com/CatsRule2023/status/1863653354909389166, https://archive.is/tZhov] Then someone asked "SEAL?" And she replied that she was a spook: "Sorry, no. Spook here. Love the Seals, though. How about you?" [https://archive.is/2gCXL]
An announcement from 2005 said: "What was formerly NAVSECGRU has now become NETWARCOM's Information Operations Directorate." [https://coldwar-c4i.net/NSG/NNS051005-04.html] The announcement also said: "The IO warfare area is composed of five core integrated capabilities: Electronic Warfare, Computer Network Operations, Psychological Operations, Military Deception and Operational Security." So I asked RexesRule if she worked for the deception capability or psyop capability of NAVSECGRU, but she didn't answer me.
Later after I got Kevin McCairn to denounce Greg's ORF hoax, Greg Harrison posted a tweet where he wrote "And at this point in time, wish to retract my ORF 'rantings' due to our lack of credible evidence that any of our ORF stuff actually exists." [https://x.com/Greg21143362/status/1908007680406589892] After that RexesRule and CoyoteSanctuary also seem to have conceded that the ORFs were fake. However that doesn't mean that they couldn't have been complicit in Greg's operation, because it wouldn't have made sense for them to keep supporting Greg's ORF hoax after Greg himself had retracted it.
But on the other hand it's possible that RexesRule is just a useful idiot, because the oldest tweet that matched @RexesRule @Greg21143362
was only from February 2025, which decreases the likelihood that she would somehow be part of Greg Harrison's team that produces disinformation. And similarly the oldest tweet that matched @CoyoteSanctuary @Greg21143362
was only from December 2024.
In September 2024 Laura Kasner posted a PDF document about the clots titled "A New Iatrogenic Disease? a detailed compositional and histopathological analysis of white clots". The cover of the PDF said "authors remain anonymous for safety reasons" even though Kasner wrote that Greg Harrison was one of the authors: [https://laurakasner.substack.com/p/how-the-white-clots-are-formed]
A version of the PDF with OCR was posted here: https://5nn.info/temp/Sos_Press_Release_August_2024–OCRed/Sos_Press_Release_August_2024-OCRed.pdf.
The document was described as a press release, but it had a big red "TOP SECRET" seal on the cover page. A "top secret press release" sounds like an oxymoron.
In the PDF for the top secret press release by SOS, there was this plot which showed the amount of zinc that was supposedly present in 8 different calamari clot samples:
And on the next page there was this plot that showed that there was 100% or close to 100% variance in the amount of zinc in the samples (even though the ppm values for zinc didn't seem to be anywhere close to maximally variable):
When I measured the pixels to approximate the ppm values of zinc in each sample, and I multiplied the variance of the ppm values by 100, the result was about 62%:
> v=c(102,71,33,55,58,33,46,36)/150*5 > var(v)*100 [1] 61.57937
But actually I don't even know how you're supposed to calculate a variance percent that is constrained to the range 0-100%, because my code above can produce percentages that exceed 100%, and SOS seems to have used some other method to calculate the variance percentages. When I asked ChatGPT how to calculate a variance percent, it suggested this formula:
> sqrt(var(v))/mean(v)*100 [1] 43.395
But that formula can sometimes also produce values above 100%. When I asked ChatGPT how to constrain the values to the range of 0-100%, it suggested the formula: sqrt(var(v))/mean(v)*100
. But that also produced a value above 100% for some inputs. Next ChatGPT suggested this formula: var(v)/(max(v)-min(v))^2*100
. But that doesn't seem to be any standard way to calculate a variance percentage either. And in any case the ppm values for zinc presented by SOS don't seem to be maximally variable (whatever that would mean).
I asked Greg Harrison multiple times how the variance percentages were calculated, but he never answered me. So I suspect his ICP-MS data may have been fake like his data about the ORFs.
The top secret press release by SOS included this image with the caption "Worm-like fibrous clot from a patient who died from COVID disease":
When I did a reverse image search for the image, I found that the same image was featured in a paper published in 2019 with the caption "Long fibrin clot completely occluding the catheter lumen of an Indwelling pleural catheter (IPC). It was pulled out intact using a pair of forceps from a non-draining IPC with suspected IPC-related infection": [https://www.researchgate.net/figure/Long-fibrin-clot-completely-occluding-the-catheter-lumen-of-an-Indwelling-pleural_fig3_334522712]
A pleural catherer is a tube that drains fluid from the pleural space, which is the space between two membranes that surround the lungs:
In addition to performing ICP-MS to analyze the elemental composition of the clots, SOS are supposed to have also performed HPLC-MS to analyze the protein composition of the clots. The top secret press release included three pie charts like this which showed the 21 most abundant proteins in the clot samples: [https://laurakasner.substack.com/p/how-the-white-clots-are-formed]
The charts only include fibrinogen but not fibrin among the 21 major constitutents. The anonymous authors at SOS wrote:
The authors suspect that Hirschman clots are composed primarily of fibrinogen that has not been converted to fibrin by the action of thrombin.
[…]
A distinctive feature of Hirschman clots is the relative lack of fibrin and the apparent lack of thrombin to convert fibrinogen to fibrin. It is currently unknown whether thrombin is absent, present but somehow disabled, or otherwise inhibited.
In the hypothetical case of synthetic (iatrogenic) clot causation as a result of COVID vaccines, the Spike Protein (produced by the host cells) and the lipid nanoparticles may act as the initiators of the clotting cascade. In the absence of functional thrombin, the clotting cascade may instead utilise partially disassociated fibronectin rather than fibrin, resulting in a long, rubbery clot.
However when I showed one of the pie charts to ChatGPT and asked it the chart should also include fibrin, ChatGPT said:
The mass spectrometry data from your blood clot sample shows high levels of fibrinogen chains - beta, gamma, and alpha - which strongly suggests the presence of fibrin. In a clot, fibrinogen is converted to fibrin by thrombin, which cleaves off fibrinopeptides A and B. However, standard bottom-up proteomics workflows break down proteins into peptides for identification. As a result, the peptides detected from fibrin often look the same as those from fibrinogen unless the analysis specifically targets unique features of fibrin, like crosslinked peptides or missing fibrinopeptides.
What you're seeing in the pie chart is a reflection of this peptide overlap. The data likely includes fibrin, but it's labeled based on its precursor proteins - fibrinogen chains - because most mass spec pipelines don't distinguish between the cleaved (fibrin) and uncleaved (fibrinogen) forms without additional targeted methods. The presence of Factor XIIIa in your data supports the idea that fibrin is present and has undergone crosslinking, which is a key step in stabilizing the fibrin mesh.
To directly confirm fibrin rather than just fibrinogen, you would need to identify specific crosslinked peptides, like γ-γ or α-α chain dimers, or the absence of fibrinopeptides A and B. These are challenging to detect without specialized workflows, but they would definitively indicate fibrin formation. In summary, while the chart labels these proteins as fibrinogen chains, the biological context and presence of clot-related factors make it very likely that you're analyzing fibrin, just not labeled as such by default in the proteomics output.
So when the anonymous authors at SOS wrote that "Hirschman clots are composed primarily of fibrinogen that has not been converted to fibrin", the authors may have been confused by how the mass spec results only included fibrinogen but not fibrin.
Similarly in a study where the authors used quantitative liquid chromatography mass spectrometry to analyze the protein composition of fibrin clots, fibrin was not listed as a major component of the clots, but only fibrinogen and fibronectin: "Among 494 clot-bound proteins identified in all clots, the highest concentrations were for fibrinogen chains (about 64% of the clot mass) and fibronectin (13%). α2-antiplasmin (2.7%), factor XIIIA (1.2%), complement component C3 (1.2%), and histidine-rich glycoprotein (HRG, 0.61%) were present at relatively high concentrations. Proteins present in concentrations <0.5% included (pro)thrombin, plasminogen, apolipoproteins, or platelet factor 4 (PF4)." [https://www.sciencedirect.com/science/article/abs/pii/S1874391919302593]
I have busted SOS presenting AI-generated data as real, so I'm not sure if their HPLC-MS data was also AI-generated. I told ChatGPT: "generate fake mass spec proteomics results of a fibrin blood clot sample which shows percentage of each protein". It produced this table which looks somewhat similar to the results by SOS, and it's also missing fibrin but it only includes fibrinogen and fibronectin:
Next I asked Grok if these HPLC-MS results of blood clots looked fake or AI-generated:
Grok brought up these points:
However I'm not yet sure if the data is AI-generated or not.
Kevin McCairn asked Greg Harrison to publish his raw files of the mass spectroscopy data, but Greg said something to the effect that he was not able to provide the files because it may have risked identifying the instrument or analyst who performed the analysis, and he himself only had access to summary data similar to the pie charts. (But if the analyst did not want to provide the raw files, couldn't Greg have just asked the analyst to share more detailed data as a CSV file or something?)
On Kevin McCairn's Discord there's a user called Centropede who is familiar with mass spectroscopy, who thinks Greg's mass spectroscopy data might be fake:
In March 2025 McCairn livestreamed an experiment on his Discord where he took ground up pieces of a calamari clot and injected them into the heart of a hamster.
Wayne Crouch posted an infographic about how McCairn killed a hamster after injecting it with "our amyloid jab clot samples". The graphic said that Kevin McCairn was linked to "Solution of Scientists", which is the group that Wayne Crouch and Greg Harrison are part of. Crouch is supposed to be a journalist, but in his infographic he somehow managed to misspell the words "scientist's", "hampsters", and "acess": [https://x.com/WayneC50256258/status/1904696389176803605]
Wayne Crouch published the same image on Facebook with the following text: [https://www.facebook.com/PureMediaAustralia/posts/pfbid02eEx7h76h64g7Bj1EkBzDkxHGnJ5VrXAubJsnM6eojjGenytdbVhCn6ySdNLWanLHl]
So good news is we were able to have one of our clots cryogenicly frozen ground to dust and injected into lab hamsters to test how long it took for these amyloid filled prion laden monsters to cause death.
We were expecting in six months to get the data …. we got the data early ….
Now the bad news is we got it early because the hamsters all died straight away meaning we are in big big trouble this is as bad as it gets.
Had they died in weeks or months maybe we had a few years longer the rapid death of our test subjects means we will see the rapid death to the shot recipients boosters will greatly accelerate this.
Now we perform dose range finding we do that by halving dose to give us a baseline estimate on how long it takes for full blown disease to take hold.
Note how Crouch spoke of McCairn's experiment as an experiment that was performed by "we". Crouch wrote that "the hamsters all died", even though I think there was just a single hamster that died. And anyway McCairn's experiment was awful evidence that "we will see the rapid death to the shot recipients" like Crouch wrote. Why would vaccinated people start dying rapidly years after vaccination? Is there some kind of a switch that will get triggered years after vaccination after which people will start dying rapidly?
In March 2025 Tom Haviland published a Substack post where he described McCairn's analysis of the clots. [https://laurakasner.substack.com/p/a-horrifying-breakthrough-in-the] Haviland wrote that Greg Harrison was the "lead scientist" of a team that was analyzing the clots, and that Harrison asked Hirschman to send the clots to McCairn, and that Harrison asked McCairn to check the samples for the presence of prions:
Laura Kasner, embalmer Richard Hirschman and I have been in contact for the last year with a scientific team led by retired organic chemist Mr. Greg Harrison. Greg's team, which is spread over several continents and includes scientists at several unnamed universities, have been analyzing samples of the "white fibrous clots" provided by Hirschman, trying to determine their exact composition and the mechanism by which these strange clots are forming.
[…]
Lead scientist Greg Harrison wondered if this abnormally high amount of phosphorus in the white fibrous clots could be partly or largely responsible for why the clots were forming.
[…]
Greg asked Richard Hirschman to send multiple samples of the white fibrous clots to Dr. Kevin McCairn, a distinguished neuroscientist in Japan who has spent his career studying the effects of amyloid proteins on patients suffering from Alzheimer's, Parkinson's disease, and dementia. Greg asked Dr. McCairn to check the white fibrous clot samples for the presence of prions.
Haviland's Substack post included a document called Kevin_Mccairn_Findings.pdf
which described the results of McCairn's analysis of the clots. The authors of the document were anonymous and the document was signed "The Researchers", but McCairn told me he was not involved in writing the document. However one of the authors was probably Greg Harrison, because in 2024 Laura Kasner posted another similar PDF about the clots, where the cover of the PDF said that the "authors remain anonymous for safety reasons" even though Kasner wrote that Greg Harrison was one of the authors. [https://laurakasner.substack.com/p/how-the-white-clots-are-formed]
The document about McCairn's findings said that "ORF-19 and ORF-11 are now functionally implicated in the induction of prionic seeding":
The names of ORFs were written with a hyphen in the PDF. The names of ORFs are normally written without a hyphen, but Greg Harrison and Wayne Crouch have both written the names of ORFs with a hyphen. [https://x.com/search?q=%22orf-19%22&f=live, https://puremediaaustralia.org/reading-room-1/f/an-unholy-triadthe-birth-of-a-plague-episode03?blogcategory=TECHNOLOGY]
McCairn told me: "You seem incapable of understanding that I am working independently and the only link is that is that Greg claims to have done some investigation on the clots. What he has done has nothing to do with my lab analysis." But I linked to the Kevin_Mccairn_Findings.pdf
document and asked him: "If you're so independent from Greg et al. then why did they write this report about your findings?" And McCairn replied: "I have no idea, and I did not give them permission to write that report or associate it with me any way."
Kevin McCairn's website has a section called "Prion Research Investigation Project". It includes a stock photo of people in a lab that I thought looked just like the stock video of people in labs in An Unholy Triad: [https://synapteklabs.com/prion-research-investigation-project/]
But then I found that McCairn's stock photo came from the same collection of stock footage that was used in An Unholy Triad: [https://elements.envato.com/microbiologist-doctor-taking-a-blood-sample-tube-f-6RYNWUU, https://elements.envato.com/user/DC_Studio/stock-video?searchTerm=lab]
I thought that the stock photo on McCairn's website might have been a clue that the same people who made An Unholy Triad were also involved in making McCairn's website. But McCairn told me that the page on his website was made by Chris France who has also made other parts of his website.
Greg's AI seems to have prophesied the results of McCairn's Rt-QuIC analysis, because in December 2024 Greg wrote: "Thx Kevin, will send you emails with word docs attached in which AI is now telling us we have identified a new blood-born Amyloid-prion disease. All is conjecture but AI seems highly convinced we shall soon identify this new Amyloid-Prion hybrid disease with deep NMR's & RT-QuIC, plus a few more techniques to properly nail it. Interesting times ahead..thx Gregh" [https://x.com/Greg21143362/status/1868544701453983855] Next in December 2024 Greg posted this tweet about how they were going to soon send Hirschman's clot samples to McCairn: "Thank you Kevin, our embalmer white clot samples shall soon follow, preserved under Argon/dipped briefly in 70% ethanol, properly sealed - for both NMR & RT-QuIC amyloid-prion oligomer detection…we hope to soon send younger white clot samples from 20-30 year olds, same as we found positive for 55 & 90 year old Amyloid ThioflavinT/UV under microscope as appears here…Merry Christmas Wishes !! Greg & Richard…👋" [https://x.com/Greg21143362/status/1871488748422418854] Later after McCairn had presented the initial results of his analysis, Greg's AI now said that the presence of amyloid prions had been confirmed with a 95% confidence level: "Yes - confirmed amyloid-prion presence with 95% confidence level according to our 3 AI engines in concert with each other…don't ask me which engines, these are the paid-for academic and proper research engines we using…not the useless free ones…" [https://x.com/Greg21143362/status/1904322522608447848] In March 2025 Greg posted this reply to a tweet about An Unholy Triad: "Thank you Wayne & Lisa, Episode 4 will expand in detail re relative pathogenicity of EACH ORF discovered so far. The 12 embalmers white clots samples provided yesterday to Dr Kevin McCairn for RAMAN & RT-QuIC analysis will reveal & substantiate the facts presented in this video series." [https://x.com/Greg21143362/status/1898486854099550605]
Greg Harrison is promoting a similar narrative about a prion apocalypse as McCairn. Wayne Crouch's cohost lady also says that there's a prion apocalypse coming: [https://x.com/lisarose030387/status/1909497793338917050]
In February 2025 Kevin McCairn appeared in a video about the white clots on Steve Kirsch's VSRF channel, which also featured Kevin McKernan, Richard Hirschman, Tom Haviland, and Greg Harrison. [https://rumble.com/v6k0oav-vsrf-live-164-white-clot-roundtable.html] Kirsch seems to have been a central player in the story about the white clots, because he was one of the very first big names in alt media who started talking about the clots, and I think he was the second person after Jane Ruby who interviewed Richard Hirschman. And I think Kirsch was the first person who interviewed Anna Foster and Cary Watkins who were the next two people after Hirschman who said they had seen the clots. And the Died Suddenly also movie included more footage of Kirsch than any other person apart from Hirschman. And the results of Haviland's embalmer surveys were published by Kirsch, and Kirsch has hosted video roundtables about the clots. So I thought that McCairn might have somehow become involved with the clots through Kirsch, because J.J. Couey said: "Steve Kirsch wanted me to evaluate Kevin McCairn's grant proposal in 2022, and we had a nice little text exchange on my phone about that. And so there again, he even offered to send me to Tokyo to help him work, and help him do those experiments." [https://www.youtube.com/watch?v=QpTQNgFCKZw&t=1h30m25s] So I asked McCairn on his Discord if he was getting paid by Kirsch, but he told me "No money from Kirsch, I did send him a grant proposal though, he took my grant and proposed a US institute carry out the work, I didn't see anything beyond that." (And McCairn doesn't seem to have too many other connections to Kirsch, but regardless I'm nearly certain that Kirsch is controlled opposition, so it's suspicious that McCairn was featured on Kirsch's VSRF channel.)
The Twitter user Sudden and Unexpected posted a TikTok video where some guy said: "See, back in early 2013, I participated in mRNA-based immunomodulatory medication trial. So, yeah, a medical trial on an mRNA-based medication that was meant to alter how the T-cells produced antibodies. And it worked phenomenally for not just lupus, but also for colitis, Crohn's disease, multiple sclerosis as well. Here's the kicker. Out of that trial, there were over 200,000 participants. And every last one of us, including myself, had their heart stop. There's less than five of us that are still alive today, but all of us experienced our heart stopping at least once. According to my doctor, less than five of us are still alive." [https://x.com/toobaffled/status/1911863358619525234]
Then Wayne Crouch replied: "This is my mate, his name is Randell and yes this is what happened to him he has been gutted like a fish almost and tossed back together, he was lucky to have survived the ordeal and likely the only victim that actually is left alive talking. I know the full details as to who did what to him or as full as he could give to me and I can tell you right now he is not a liar, even after all the threats and back lash he still tries to save people from going through what he has half the attacks are likely paid for by big pharma the rest are so bloody wrong and out of touch with reality it just ain't funny." [https://x.com/WayneC50256258/status/1911971108947153391]
In October 2024 the journal IJVTPR published a paper by Daniel Santiago about N1-methylpseudouridine, where he also discussed the calamari clots. [https://ijvtpr.com/index.php/IJVTPR/article/view/110]
Daniel Santiago is a member of the editorial board of IJVTPR, which also includes the nanotech guys Daniel Broudy and Shimon Yanowitz. [https://ijvtpr.com/index.php/IJVTPR/about/editorialTeam] In 2022 Yanowitz told Sasha Latypova that when he looked at his blood under a microscope, he found a synthetic fiber which may have been a Morgellons fiber. [pfizerstew.html#Links_of_Latypova_and_Kingston_to_Stew_Peters_and_Jane_Ruby]
IJVTPR is the journal that published the infamous nanobot paper in 2024 by Daniel Broudy and Youngmi Lee. [pfizerstew.html#Paper_about_nanotechnology_in_COVID_vaccines_by_Young_Mi_Lee_and_Daniel_Broudy] And IJVTPR has published three other papers about nanotechnology in COVID vaccines by Daniel Broudy, David Hughes, and Valerie Kyrie, who all have a background in psychology or propaganda research, and who all write for a website called Propaganda in Focus. Valerie Kyrie's bio says that she works "in the areas of political psychology, the psychology of atrocity, and psychological operations / perception management" and that "her doctorate in psychology focused on the topic of reality-perception and its manipulation". [https://ijvtpr.com/index.php/IJVTPR/article/view/49] Daniel Broudy has a doctorate degree in applied psycholinguistics and he used to work in military intelligence, and his bio says: "My work integrates research in linguistics, psychology, and communication theory to describe ways in which power centers design and conduct propaganda campaigns." [https://www.researchgate.net/profile/Daniel-Broudy] The bio of David Hughes says that he lectures in security studies and that his areas of research include psychological warfare and "the class relations behind psychological operations". [https://propagandainfocus.com/our-team/]
In 2022 IJVTPR published a paper by David Hughes which included photos of La Quinta Columna's microchips and Carrie Madej's hydras: [https://ijvtpr.com/index.php/IJVTPR/article/view/52/288]
A few days later IJVTPR published a response by Daniel Santiago to the paper by Hughes. [https://ijvtpr.com/index.php/IJVTPR/article/view/56] Santiago had little negative to say about the paper, and he didn't question if the vaccines contain hydras, microchips, or nanobots. But instead Santiago just said that vaccines didn't contain nitrogen or phosphorous, which he presented as evidence that vaccines did not contain DNA or RNA but instead they contained "XNA" (xeno nucleic acids), and he wrote that vaccines contained "intentionally manufactured self-assembling components, built mainly from carbon-based materials used in computing and super-conductors":
What is missing from the spectral analyses of the foreign elements in the main COVID-19 vaccines, Pfizer and Moderna for certain, and probably also missing from the other experimental products being widely distributed that are known to contain foreign aggregates of strange materials similar to those found in the Moderna and Pfizer injections, are the elements nitrogen and phosphorous. This is revealing because all natural DNA, RNA, and their protein products contain those missing elements. Nitrogen for protein synthesis and phosphorus for DNA, RNA, and energy transfer. Therefore, their absence from the foreign structures seen under many different microscopes in all of the COVID-19 so-called "vaccines" that have been examined, and also found in blood samples of persons injected with the Moderna and Pfizer concoctions, proves that these intentionally manufactured self-assembling components, built mainly from carbon-based materials used in computing and super-conductors, are connected with the avant-guard evolutionary theory and experimentation with what is known as XNA, Xeno (Greek for "foreign"), Nucleic Acid. Most of the relevant information is behind significant paywalls in esoteric journals specializing in this peculiar branch of highly theoretical and experimental chemistry.
Daniel Santiago has 8 works listed at Orcid, but 6 of them were published by IJVTPR and the remaining 2 works are preprints. [https://orcid.org/0000-0001-5975-0592] Last year Santiago published a response to a critique of an IJVTPR paper together with 4 other editors of the journal, who included the former military intelligence agent Daniel Broudy and Shimon Yanowitz. They wrote: [https://mail.ijvtpr.com/index.php/IJVTPR/article/view/114]
The COVID-19 injectables contain at least 55 undeclared chemical elements including so-called "rare earth" metals and 12 of the 15 lanthanides. The likelihood that such elements are not involved in self-assembling entities in the fluids and in the unnatural clots in many recipients is zero. Ongoing gain-of-function bioweapons research together with published agendas for population reduction and control suggest that military-grade nanotechnologies are at play in the world-wide COVID-19 experiment.
IJVTPR has now deleted the paper which Santiago and other editors of IJVTPR defended, but it was mirrored here: https://rdi.uncoma.edu.ar/bitstream/handle/uncomaid/18277/21102024%2BDiblasi%2Bet%2Bal_ICP-MS_05092024.pdf. The authors of the paper wrote that the vaccine samples contained a high amount of lanthanides (which are chemical elements with atomic numbers in the range of 57 to 70), which the authors presented as evidence that vaccines contained nanotechnology: "Because the lanthanides, as we have noted above, are known to be extremely cytotoxic (Voncken, 2016; Balaram, 2019), their being discovered in significant quantity, and across the whole array of vaccines we have studies here, is suggestive of some kind of nanotechnological experimentation along the lines being discussed by Kyrie & Broudy (2022), Lee and Broudy (2024a), Hughes (2024), and others." The papers by Kyrie, Broudy, and Hughes the authors cited were all papers about nanobots in COVID vaccines that were published in IJVTPR.
The paper that Santiago defended was so fake that even Mike Adams wrote this about the paper: "The study is a hoax. The ICP-MS instrument can't detect 'chemicals' in the first place. The reported numbers for many elements are far beyond the sensitivity capabilities of the instrument. The sample prep procedure is bizarre. The dilution calculations are wrong. The scary-sounding language of 'undeclared' elements isn't scientific or rooted in any regulatory requirements at all." [https://www.naturalnews.com/2024-10-16-the-chd-touted-science-paper-claiming-55-undeclared-chemical-elements-were-found-in-covid-vaccines-is-a-hoax-and-must-be-retracted-heres-why.html]
On April 7th 2025 UTC a channel called Flashlights published an interview of Greg Harrison and Tom Haviland. [https://rumble.com/v6rq775-do-mrna-covid-shots-cause-the-misfolding-of-proteins-in-humans-greg-harriso.html]
I don't know if the interview was recorded earlier, because Greg was still talking about his ORF hoax in the interview, even though on April 4th UTC he tweeted that "And at this point in time, wish to retract my ORF 'rantings' due to our lack of credible evidence that any of our ORF stuff actually exists." [https://x.com/Greg21143362/status/1908007680406589892]
Tom Haviland also seemed to support the story about the ORFs, and he said: "But in the open literature you'll only see papers that like identify the SARS-CoV-2 virus from ORFs 1 through 10. And then it stops there as if that's the entire length of the code, that's all. What Greg is saying there seems to be evidence that there's more ORFs - more open reading frames - than what has been published in these published papers." [1:09:06]
Earlier I wasn't sure if the mystery ORFs are supposed to be ORFs of the virus or vaccine or both. But now Tom Haviland said this about the ORFs: "What are the chances that if they're in the virus that they may be in the COVID mRNA vaccine?" [1:13:02] And Greg Harrison answered: "We know that ORF11 and ORF19 are highly transcribed into the mRNA vaccination spike." So I guess it means that ORF11 and ORF19 are supposed to be ORFs of the spike protein that are included in both the virus and the vaccine (even though the mRNA vaccines don't even have the same ORFs as the virus because of the codon optimization).
During the video Greg also said: "So, the HPLC analysis we did, though the gentleman by the name of Dr. Arne Burkhard who had also done the same work on Richard's white clots by I think two years before us. And he used a technique called MALDI-TOF. And MALDI-TOF is an older technique - it's not quite as definitive as the technique we used, which is HPLC - and Dr. Burkhardt got over 300 different proteins in those white clots. He also noted - he did some other histology tests on it with Congo red - and he found - and he determined there was amyloid presence in his samples. Now, unfortunately, Dr. Burkhardt had met an untimely death. His work has been suppressed. We haven't been able to get a copy of his analysis, because I'd like to compare it with the analysis we have." [15:06]
Then the host asked: "You said that you tried to get a copy of his analysis and you couldn't. How is that possible? I mean, it wasn't it that was at a published paper, or why couldn't you get a copy of the paper?" And Greg answered: "Yeah, Arne Burkhardt had the same problem. We've got the people who supposedly conduct his MALDI-TOF work did not want their identities released. And, we'd have - Dr. Ryan Cole, I think, has had some success trying to locate some of these people to confirm his results. But end of the day, the results were not - exactly the same reason I've got, where the professors who have done the work using their MALDI-TOF equipment don't want their names out, because they're frightened of the blowback that may occur to the universities."
But his explanation doesn't make sense, because couldn't Burkhardt have just published the results of the analysis without having to publish the names of the researchers who did the analysis?
Actually one suspicious thing about Burkhardt is that he didn't publish his results in a proper scientific format, but he presented his results in conspiracy videos that were aimed at a mass audience. I think the closest to a scientific paper he wrote was a short report he wrote together with Sucharit Bhakdi about a video he did with Bhakdi. [https://doctors4covidethics.org/wp-content/uploads/2021/12/end-covax.pdf] In the press conference that Burkhardt organized in the office of his private practice, people were saying that vaccines contained graphene oxide, minirobots, and parasites, and that the blood of a vaccinated person contained a synthetic fiber that may have been a Morgellons fiber. [turbo.html#German_pathology_conference_held_by_Arne_Burkhardt] But if Burkhardt is supposed to have analyzed the calamari clots in a lab, it's a further reason to be suspicious of him.
In the same video Haviland also said: "And the next step that he's talking about is very important because we want to see whether, uh, we could take some of the ground-up sample of the white fibrous clot, and then, uh, put that into solution, inject it into animals - test animals such as hamsters, rhesus monkeys - and see if there's this prion activity, right. If that animal develops a white fibrous clot. In other words, is the white fibrous clot material contagious, infectious? Is it seeding? Does it, then, you know, does it plant itself in this vascular system and then grow and form a white fibrous clot to kill the animal? And we want to see if that happens, and if it does happen, how quickly does it happen. Because then that - you know, if, and if it does, that's, you know, even more alarming, right? Because it proves the presence of prion material in these white fibrous clots." [1:30:55]
Kevin McCairn told me: "You seem incapable of understanding that I am working independently and the only link is that is that Greg claims to have done some investigation on the clots. What he has done has nothing to do with my lab analysis." [https://discord.com/channels/872999209182322719/1064054153183236146/1358510136867684532] So I asked McCairn why Tom Haviland said that McCairn's hamster experiment was an experiment done by "we"? But McCairn told me: "Because he's talking out of his ass, I do not have any formal relationship with them beyond receiving the clot samples and discussing what I would be doing with the samples for analysis. If they start paying me for the work, I will let you know." (However I suspect McCairn wanted to distance himself from Harrison and Haviland after I busted their ORF hoax.)
Another interesting thing Greg said in the interview with Flashlights was: "I've also been in contact with New Zealand embalmers and also John O'Looney in the UK. And so we've got - and also one Laura Jeffrey from Canada - so we've got four embalmer, four different countries, all confirming they're seeing these white clots." [https://rumble.com/v6rq775-do-mrna-covid-shots-cause-the-misfolding-of-proteins-in-humans-greg-harriso.html?start=266] And a bit later he said: "The hard analyses that we've done on Richard Hirschman's clots, and also on some clots out in New Zealand, down through Brenton Faithfull, ok - so we're matching up New Zealand clots, US clots - and I was hoping to get some samples from John O'Looney in UK, and also some samples out of Canada, from Laura, they've yet to arrive." [11:10]
So Greg is supposed to be getting clots from 4 embalmers, but 3 of them were featured in a Stew Peters movie. And the 4th one is Laura Jeffrey, who has appeared in videos by VSRF, and she helped Haviland with running at least one of his surveys, and she claimed that the white clots resembled parasites and they seemed to be feeding off the currant jelly clots. [https://nationalcitizensinquiry.ca/wp-content/uploads/2023/08/TS2303TOR204-laura-jeffery.pdf] All 4 embalmers have done videos in alt media where they have made ludicrous claims. Brenton Faithfull also said that after he first started keeping records in August 2021, 39 out of the first 40 dead people who passed through his funeral home had been vaccinated less than 2 weeks before their death. And John O'Looney claims that vaccines contain nanobots that are activated by 5G. And Hirschman said that Ana Maria Mihalcea's microscope photos of quantum dots were "pretty daggum solid proof".
In March 2025 Tom Haviland wrote "Laura Kasner, embalmer Richard Hirschman and I have been in contact for the last year with a scientific team led by retired organic chemist Mr. Greg Harrison." [https://laurakasner.substack.com/p/a-horrifying-breakthrough-in-the] But Greg Harrison seems to be the main architect behind the hoax about the fake ORFs, which is clearly a form of deliberate disinformation, so Hirschman's association with Harrison makes it seem more likely that Hirschman is also controlled opposition.
Richard Hirschman has done all these videos together with Greg Harrison (all dates are UTC):
In July 2022 Mike Adams did a video about the clots with Jane Ruby. [https://rumble.com/v1dorkz-07-26-22-dr.-jane-ruby-and-the-health-ranger-reveal-post-vaxx-clot-mysterie.html] At the start of the video Mike Adams said that Stew Peters is a treasure for humanity. [1:32]
Jane Ruby said: "Dr. Van Welbergen said - he literally watched, he's got videos, he's going to show us, eventually, but he's - he watched under the microscope, these structures pull graphene from another part of the blood. It's almost like it's got a magnetism and then pulls it into itself so that it can enlarge. I want to give you another piece of information that's, it could be a part of this or not. But Mr. Hirschman, several weeks ago, said to me that he went back to his lab refrigerator to put some additional samples in. And he said that the - there were several baggies where he - he had to look twice and he thought that they were bigger. And so he turned to his wife who helps him in the lab and he said, 'Am I, you know, crazy or are these enlarged?' So I asked him - I try to qualify it with him - 'What do you mean enlarged? Like, are we talking 10, 20 percent?' He said, 'No,' he said, 'Dr. Ruby, they're - they're like two to three times larger.' And I said, 'Well, what kind of timeframe are we talking about?' And he said 'Several days.' And like these were - these particular samples were in formalin. So the formulalin is not - which is a preservative for the audience's sake - this formalin is not discouraging the growth, it's not stopping it. So these, these, this information - I think Dr. Van Welbergen said that there's an intelligence - there's an intelligence to this graphene. It has a mission and it seems to be working when it's viewed under a microscope." [13:20]
Then Jane Ruby talked about the video where ball bearings in castor oil assembled into wires, even though she claimed it showed self-assembling of graphene. And then Mike Adams said: "Graphene is primarily made of carbon. And, and, so carbon is what we're seeing in a higher concentration in the clots compared to human blood." [17:26]
Then Mike Adams said: "That nanowire type of structure was embedded in the clot. It was not a contamination. It's not one of my own hairs, for example, that fell into the microscope. It was there, it was attached. And, you know, perhaps we could even, if we rehydrate that sample, we could look at the attachment point and get a little more detail on that. But you're right, at 1500 magnification, we were able to see these - what you might call nanowire interface structures - kind of like the edge of a circuit board, like an interface that you plug into your PC and it's got all these wires on the edge that talks to your CPU - it was like that was lining the top of this nanowire. And again, you and I are using these terms descriptively, we don't - we're not saying that for sure these are absolutely circuit boards, but that's what they resembled. So it's a mystery." [23:18]
In July 2022 Natural News published an article about a video where Mike Adams discussed his laboratory findings with Jane Ruby. The top of the article had this image of a blood clot: [https://www.naturalnews.com/2022-07-27-post-vaccine-clots-contain-detrimental-amounts-metals.html]
Ariana Love had earlier said that the same clot was "a blood clot with Hydra-like mutational growth that was removed from the heart of an early teen who received a Covid vaxx": [https://ambassadorlove.blog/2021/11/01/transgenic-hydras-parasites-a-biological-weapons-system-for-rapid-human-cloning/]
But actually it was a clot from the lungs of a heart failure patient from 2018: [https://empr.com/home/news/heart-failure-patient-coughs-up-bronchial-tree-shaped-blood-clot/]
In August 2022 Stew Peters Network published a video where Jane Ruby interviewed of Mike Adams, which they gave the title "SHOCKING: White Embalmer Clots Are Self Assembling Circuits".
Mike Adams said: "These clots are not made of blood, and they do not contain the elements that are common to human life. What they do contain in higher amounts - compared to human blood - are elements that you might find in circuitry or machinery, or electrically conductive systems." [https://rumble.com/v1glsch-live-7pm-shocking-white-embalmer-clots-are-self-assembling-circuits.html?start=763] Next he said that the clots are "self-assembling machines": "As you know, they are self-assembling biostructures. So they increase in size over time. And as they're increasing in size, they are accumulating - or harvesting from the blood - these electrically conductive elements that we've mentioned - tin, aluminum and sodium in particular. So in other words, these are self-assembling machines of some kind that are biologically, quote, 'compatible' for a period of time." [16:57]
Next Mike Adams speculated that in a similar fashion that an EMP weapon can destroy an electric circuit, the clots might make it possible to kill people with a directed energy weapon: "We know that, you know - how EMP weapons work is they use an external electromagnetic field of very high energy in order to through induction cause intense heat in circuits to where those little tiny circuits melt, and then that circuit board fails. This is one of the ways that EMP weapons take out, you know, electronics circuit board control systems and so on. The question is, through the use of external electromagnetic fields or even DEW directed energy weapons, is it possible to induce very high heat in these clot structures because they have much higher levels of conductive elements? And is it possible then that these clots could be heated to cauterize the blood vessels, or to cook someone's blood vessels from the inside? And that would cause an instant blockage of blood flow, and that could also be directed at crowds or individuals potentially." [25:12]
In August 2022 Mike Adams published a video where he said: "We noticed something really strange kind of alarming - and it's going to lead us down a deep, dark, Alice in Wonderland rabbit hole - and we noticed that some elements were higher in the clot than what they are in human blood. And three of those elements that are higher are sodium, tin, and aluminum. These three elements are all very good conductors of electricity, very good conductors of electricity." [https://www.naturalnews.com/2022-08-21-graphene-radio-frequency-electronics-biological.html, time 4:30]
And he said: "Here's what's shocking, the clot is harvesting certain electrically conductive elements out of the blood and using those elements in its machinery - however you want to describe it - mechanism to assemble itself to grow its own size and mass, while concentrating electrically conductive elements into some form that we don't yet fully understand. So the shocking takeaway from this is that the clot is very, very low in elements that are associated with human life, but the clot is much higher in elements that would be associated with artificial life built by machines." [6:31]
And next he said the clots may have utilized the kind of technology that Charles Lieber was working on, like "nano-circuitary that is interfacing with biological systems and self-assembling inside the body and interfacing with cells and even inside the cell membranes for monitoring and control systems." [9:00]
Next he said the clots may have acted in a similar manner as RFID tags, and he said: "So what we know from RFID is that if you have a pattern of circuitry, it can respond to external electromagnetic, impulses or radiation. In addition, we know from studying EMP weapons and solar flares and so on, that circuits can be made very, very hot when there's enough external energy directed at them. In other words, the circuits kind of funneled the energy of the electromagnetic broadcast and it can create a lot of heat. And this is what fries the microcircuitry in devices during an EMP attack. There's too much voltage that is, well, inductive current that goes through the circuits, they get too hot and then they melt." [12:27] And next he said the clots might similarly cause people to die from an EMP or a solar flare, and the clots would make possible to kill people remotely with directed energy weapons or 5G because the circuitry in the clots would generate so much heat.
He said: "Well, what happens if those clots are heated by some external electromagnetic event, which again could be a solar flare - could be EMP weapon, could be a broadcast, you know, you start to ask questions - are 5G towers capable of this? What kind of broadcast systems could induce current and heat inside the clots? Well, at a certain point, a certain temperature in that clot, it's going to cook the blood vessel in which it resides." [15:57]
He also said: "There was a video, came out a while ago -and to this day, I don't know if that video was a hoax or something real - but it appeared to depict someone in Brazil who reportedly was vaccinated and was hit with one of these weapons and smoke - at least in this video, it may have been fake, we don't know if this is real - but in the video, smoke began to pour out of his eyeballs and his brain cooked from the inside. Now, I don't have that video. It appears to have been completely scrubbed off the internet, but I did see it."
Mike Adams didn't directly discuss graphene himself during the video, but Natural News published an article about the video by someone called Ethan Huff, who wrote: "The 2014 study mentioned earlier discusses how graphene is used to create tiny circuit boards of microscopic size that enhance the conductivity and use of other metals. Could it be that Fauci Flu shots are self-assembling tiny circuit boards from metals siphoned from the blood, resulting in clots?" [https://www.naturalnews.com/2022-08-21-graphene-radio-frequency-electronics-biological.html]
Mike Adams is supposed to have analyzed the composition of a calamari clot sample with ICP-MS (inductively coupled plasma mass spectrometry). In the original post about the ICP-MS results by Natural News, the results were split across multiple tables, carbon and calcium were missing, and the concentration of chlorine was erroneously shown as ppm instead of ppb. [https://www.naturalnews.com/2022-08-17-elemental-analysis-results-released-vaccine-clot-composition-not-blood-clots.html] But two weeks later Epoch Times published this table where the error was fixed, and carbon and calcium were added (even though the table was missing some minor elements that were included in the PDFs of the full-quant results that Mike Adams posted earlier): [https://www.globalresearch.ca/embalmers-have-been-finding-numerous-long-fibrous-clots-lack-post-mortem-characteristics/5792728]
The only elements which differ by more than an order of magnitude between the clot and the control are magnesium, potassium, and iron, which are all more than an order of magnitude lower in the clot than in the control blood sample. Mike Adams noted the low levels of iron and potassium when he wrote: "One conclusion is inescapable: The clot is almost entirely lacking key marker elements that would be present in human blood (such as iron and potassium) yet shows significantly higher concentrations of elements that are used in electronics and circuitry."
Mike Adams did not point out that his control sample had very high levels of tin and aluminum:
In the table below I included a column for a typical ppm level of each element in human blood, which which also shows how the control sample has an extremely high level of aluminum:
# | Element | Control | Clot | Typical | Clot/Control | Control/Typical | Clot/Typical |
---|---|---|---|---|---|---|---|
12 | Magnesium | 35 | 1.7 | 20 | 0.05 | 1.8 | 0.09 |
19 | Potassium | 1893 | 12.5 | 150 | 0.007 | 13 | 0.08 |
26 | Iron | 462 | 20.6 | 1000 | 0.04 | 0.5 | 0.02 |
29 | Copper | 1 | 0.3 | 1.0 | 0.3 | 1 | 0.3 |
30 | Zinc | 7.9 | 2.4 | 1 | 0.3 | 7.9 | 2.4 |
13 | Aluminum | 1.3 | 1.6 | 0.002 | 1.2 | 650 | 800 |
11 | Sodium | 1050 | 1500 | 3250 | 1.4 | 0.3 | 0.5 |
6 | Carbon | 137 | 153 | 300 | 1.1 | 0.5 | 0.5 |
20 | Calcium | 74 | 23.8 | 95 | 0.3 | 0.8 | 0.3 |
50 | Tin | 0.163 | 0.943 | 0.0084 | 5.6 | 19 | 112 |
17 | Chlorine | 930 | 290 | 3600 | 0.3 | 0.3 | 0.08 |
15 | Phosphorus | 1130 | 4900 | 35 | 4.3 | 32 | 140 |
Another weird thing about the analysis by Mike Adams is that he is only supposed to have used one unvaccinated blood sample as a control. He could've at least taken the median of 3 samples or something, because his control sample might have had an unusual level of some elements. Or if his equipment was contaminated, he might have been able to detect it if he ran multiple control samples but they all got an unusually high level of some element, like aluminum or tin.
I thought that maybe Mike Adams accidentally reported the level of aluminum as 1.3 ppm even though it was supposed to be 1.3 ppb. But this table also shows that the level of aluminum was supposed to be about 1341 ppb in the control sample: [https://www.naturalnews.com/2022-08-17-elemental-analysis-results-released-vaccine-clot-composition-not-blood-clots.html]
The post in my previous link has links to PDFs which include the ICP-MS results of some additional elements that were missing from the table at Epoch Times. [https://www.naturalnews.com/files/CWC-Blood-Test-ICPMS-results.pdf, https://www.naturalnews.com/files/CWC-Clot-Test-ICPMS-results.pdf] I included the results from the PDFs in the next plots, which show that elements with a low typical ppm level in human plasma tend to have relatively high level in both Mike's clot sample and his control sample (which I thought might have been due to a limit of precision of the instrument, but ChatGPT said it was not likely and that contamination was a more likely explanation):
t=fread(text="group,element,name,control,clot,typical Alkali/alkaline earth metals,Mg,Magnesium,35495.372,1665.925,20000 Post-transition metals,Al,Aluminum,1340.926,1576.237,2 Alkali/alkaline earth metals,K,Potassium,1893465.535,12489.148,150000 Transition metals,V,Vanadium,63.192,24.804,0.3 Transition metals,Cr,Chromium,141.959,87.809,0.5 Transition metals,Mn,Manganese,60.151,48.348,1 Transition metals,Fe,Iron,461937.474,20628.016,1000 Transition metals,Ni,Nickel,150.930,177.544,0.2 Transition metals,Cu,Copper,1078.000,300.832,1500 Transition metals,Zn,Zinc,7921.811,2411.749,1000 Post-transition metals,As,Arsenic,23.955,73.708,0.02 Non-metals,Se,Selenium,334.425,241.310,70 Alkali/alkaline earth metals,Sr,Strontium,206.405,166.406,0.3 Transition metals,Mo,Molybdenium,24.187,61.011,0.2 Post-transition metals,Cd,Cadmium,30.071,27.65,0.05 Alkali/alkaline earth metals,Cs,Cesium,17.920,4.874,0.005 Post-transition metals,Pb,Lead,66.263,23.154,35 Actinides,U,Uranium,3.608,1.503,1 Alkali/alkaline earth metals,Na,Sodium,1050000,1500000,3250000 Non-metals,C,Carbon,137000,153000,300000 Alkali/alkaline earth metals,Ca,Calcium,74000,13800,95000 Post-transition metals,Sn,Tin,163,943,8.4 Non-metals,Cl,Chloride,930000,290000,3600000 Non-metals,P,Phosphorus,1130000,4900000,35000",na="<0.000") t[,group:=factor(group,c("Non-metals","Alkali/alkaline earth metals","Transition metals","Post-transition metals","Actinides"))] a=t[,.(control=sum(control),clot=sum(clot),typical=sum(typical)),.(group,name=sub("-.*","",name))] a=a[!is.na(control)&!is.na(clot)] p=a[,.(group,name,x=c(control,typical,typical)/1e3,y=c(clot/control,clot/typical,control/typical),facet=rep(1:3,each=.N))] xtit=c("Control blood sample ppm","Typical ppm in human plasma")[c(1,2,2)] ytit=c("Ratio between Hirschman clot and control blood sample","Ratio between Hirschman clot and typical plasma","Ratio between control blood sample and typical plasma") breaks=10^(-10:10)breaks=c(c(1,3)%o%10^(-10:10))
lab=sub("\\+0","",sub("-0","-",sprintf(ifelse(breaks<0.01,"%.0e","%.3g"),breaks))) for(i in 1:3){ ggplot(p[facet==i],aes(x,y))+ geom_vline(xintercept=0,linewidth=.4,color="gray60")+ geom_hline(yintercept=1,linewidth=.4,linetype="42")+ geom_point(aes(color=group),size=.6)+ ggrepel::geom_text_repel(aes(label=name,color=group),size=3.5,max.overlaps=Inf,segment.size=.3,min.segment.length=.2,box.padding=.07,show.legend=F)+ labs(title="Analysis of Hirschman clots published by Mike Adams",x=xtit[i],y=ytit[i],subtitle="Source: naturalnews.com/2022-08-17-elemental-analysis-results-released-\nvaccine-clot-composition-not-blood-clots.html")+ scale_x_log10(limits=range(p$x),breaks=breaks,labels=lab)+ scale_y_log10(limits=range(p$y),breaks=breaks,labels=lab)+ coord_cartesian(clip="off")+ guides(color=guide_legend(ncol=3,byrow=F))+ theme(axis.text=element_text(size=11,color="black"), axis.text.x=element_text(margin=margin(3)), axis.ticks=element_line(linewidth=.4,color="black"), axis.ticks.length=unit(4,"pt"), axis.title=element_text(size=11), axis.title.x=element_text(margin=margin(3)), axis.title.y=element_text(margin=margin(,2)), legend.background=element_blank(), legend.box.spacing=unit(0,"pt"), legend.key=element_blank(), legend.key.height=unit(13,"pt"), legend.key.width=unit(16,"pt"), legend.position="top", legend.spacing.x=unit(2,"pt"), legend.spacing.y=unit(0,"pt"), legend.margin=margin(,,4), legend.text=element_text(size=11,vjust=.5), legend.title=element_blank(), panel.background=element_blank(), panel.border=element_rect(fill=NA,linewidth=.4), panel.grid.major=element_blank(), plot.margin=margin(4,11,4,4), plot.subtitle=element_text(size=10,margin=margin(,,2)), plot.title=element_text(size=11,face=2,margin=margin(1,,4),hjust=0)) ggsave(paste0(i,".png"),width=5.5,height=4.5,dpi=300*4) system(paste0("mogrify ",i,".png -trim -resize 25% -bordercolor white -border 30 -colors 256 ",i,".png")) }
In the last plot above where Mike's control sample is compared against a typical ppm in human plasma, one thing that stands out is that the three elements which would typically be the most abundant in human plasma all have a relatively low level in Mike's control sample.
In 2022 Mike Adams was the first person to publish the results of a laboratory analysis of the calamari clots, after Jane Ruby asked Hirschma to send his clots to Mike Adams. He looked at the clots under a microscope and he did an ICP-MS analysis of the clots where he found a high level of metals.
Three years later in 2025, Mike Adams now said that Jane Ruby had sent him a sample of mysterious chemtrail fog, and he found a high level of metals in the sample with ICP-MS. When he looked at the chemtrail fog sample under a microscope, he also saw "biological life forms": [https://x.com/HealthRanger/status/1907475744823107864]
Mike Adams also tweeted that people are being mass-poisoned by weaponized fog, and he posted a microscope photo of a blue fiber-like structure which people on Twitter were saying was a Morgellons fiber: [https://x.com/HealthRanger/status/1908402667396669751]
Mike Adams also wrote that he had found a structure in the fog that had "parallel lines that connect like circuitry" (just like how in 2022 he was saying that the calamari clots contained electric circuits): [https://x.com/HealthRanger/status/1907960000862892179]
A week later Mike Adams reported that he had now found early signs of life forming in Jane Ruby's chemtrail fog: [https://x.com/HealthRanger/status/1910466399689941312]
Mike Adams also published video where he looked at Jane Ruby's sample of fog under a microscope (or strictly speaking it was supposed to be a sample of dust and other material that had been collecting on a sheet of plastic, but it was collected during a period when there is supposed to have been a strange fog seen in Florida). Mike said that the sample contained "diploid egg structures", fibers, and structures that looked like they might be algae: [https://x.com/HealthRanger/status/1907517172248887411, time 1:47:18]
He also showed this diploid egg structure below and he said "Yeah, so I mean, that is a, that's some kind of a life form structure, right? Clearly. that doesn't appear like that just spontaneously, randomly in nature. Something built it."
Ana Maria Mihalcea has a unique theory on how the calamari clots are formed, because she told Mary Holland from CHD that the clots are formed when nanobots eat red blood cells: "I analyzed these clots microscopically and found these nanotechnological filaments in there. And Clifford Carnicom and I - we also did chemical analysis on them. I also filmed how the clots actually assemble. What you see is unvaccinated blood, the nano robotic swarm. You see all these green and orange and yellow lights. And they are hijacking the electricity from the red blood cells, and they're killing them basically to feed themselves. It's called energy harvesting, it's well described in the nanotechnological literature. And so these robots then, what they leave in their wake is this. This is the same blood 30 minutes later. The blood is completely destroyed. The robots have moved on. And this is the rubbery clot that we've been seeing. And that you can see how it self-assembles, and literally builds when you are leaving the - when you're drawing the blood, and you are leaving it out for at least four hours." [https://rumble.com/v5gadat-what-is-in-our-blood.html?start=2510] The image below shows her "nanorobotic swarm" of green and orange and yellow lights (and it's also depressing to note that her interview with CHD has 101 upvotes and 1 downvote on Rumble):
During the interview with Mary Holland from CHD, Mihalcea also said:
But somehow Mary Holland didn't have anything critical to say to Mihalcea, and she never asked Mihalcea questions like "How do you know that?" or "What's your source?" or "How can you see nanotechnology with a light microscope?" or "Isn't that just Brownian motion and not quantum dots?"
During the same interview with CHD, Ana Maria Mihalcea also claimed that the calamari clots contained spider silk protein. She said: "Clifford Carnicom and I have got the deceased clots from Richard Hirschman, we got a clot from a living vaccine injured person, and from an unvaccinated individual. And what we looked at is clearly this rubber-like material that we know about. And we did by mircoscopy, and we found the same filaments that we see in the blood, absolutely the same stuff, okay. And then we did near-infrared spectroscopy and found that these things have a polyins, which is polyethylene alcohol, polyvinyl alcohol, which is plastic, and polyamide, which is silk, nylon, or Kevlar. And specifically, you know, Kevin Kerningham, Dr. Kerningham [meant McKernan] found the genes of DNA of spidroins of spider silk. That's the strongest military-grade material that they have made. And so we found these in the clots." [https://x.com/ChildrensHD/status/1845970364993798325, time 41:40] However Kevin McKernan did not actually find spidroin in the Pfizer vaccine sequence, but he found a long open reading frame on the reverse strand of the vaccine sequence, and when he searched for the ORF on UniProt BLAST using extremely liberal settings, the closest match happened to be a spidroin sequence by chance (even though it was an extremely distant match that was not actually similar at all to the reverse ORF, and it wouldn't have even been returned as a hit if he would've ran BLAST with normal settings). [https://anandamide.substack.com/p/spider-webs-in-the-pfizer-closet] Later when I repeated the same BLAST search at UniProt, there were now more new sequences that had been added to the database, so the best two matches were a protein from algae and a protein from a cockroach, but the spidroin protein only came on third place. [scripts.html#Search_for_ORFs_on_reverse_strand_in_SARS2_and_Pfizer_vaccine_contigs] Clifford Carnicom is also supposed to have found Morgellons fibers in Hirschman's clots. [http://web.archive.org/web/20230711070359/https://anamihalceamdphd.substack.com/p/blood-clot-analysis-from-living-and] Ana Maria Mihalcea and Carnicom also claim that chemtrails contain both Morgellons fibers and spider silk.
An account that promotes Miles Guo posted this video where Ana Maria Mihalcea said that she had found spider silk in calamari clots. The video included this slide about the reverse ORF from a presentation by David Speicher, which featured a photo of calamari clots as if the clots were somehow related to the reverse ORF: [https://x.com/aus_mini/status/1813411573085692059]
McKernan did not actually find spidroin in the Pfizer vaccine sequence, but he found a long open reading frame on the reverse strand of the vaccine sequence, and when he searched for the reverse ORF on UniProt BLAST using extremely liberal settings, the closest match happened to be a spidroin protein by chance, even though it was an extremely distant match, and it wouldn't have even been returned as a hit if he would have ran BLAST with normal settings. [https://anandamide.substack.com/p/spider-webs-in-the-pfizer-closet] Later when I repeated the same BLAST search at UniProt, there were now more new sequences that had been added to the database, so the best two matches were a protein from algae and a protein from a cockroach, but the spidroin protein only came on third place: [http://sars2.net/scripts.html#Search_for_ORFs_on_reverse_strand_in_SARS2_and_Pfizer_vaccine_contigs]
Ana Maria Mihalcea wrote that Hirschman's clots contained Morgellons bacteria and Morgellons fibers: [http://web.archive.org/web/20230711070359/https://anamihalceamdphd.substack.com/p/blood-clot-analysis-from-living-and]
Our findings:
1. The filament structure is a 1:1 match to our previous findings as well as consistent with 30 years of research done by Clifford Carnicom. 2. Cross Domain Bacteria, the origin of filament genesis are visible within the clots 3. This appears to produce an amorphous protein structure 4. Stray blood cells are present
It appears that the rubbery clots are a more advanced and extreme evolution of the CDB/ Morgellons filaments.
In September 2023 Hirschman tweeted: "I know that there have been some people looking into them. publicly the only people who have spoken about what they have found or seen are, Dr. Ryan Cole, Dr. Ana Mihalcea and Mike Adams. There have been others but I am not aware of any of their findings." [https://x.com/r_hirschman/status/1700596168256880863] But if Hirschman was for real, would he have wanted Ana Maria Mihalcea to say that his clots contained Morgellons fibers, Morgellons bacteria, and spider silk? Or would he have wanted Mike Adams to say that his clots contain electric circuits and nanowire interface structures? I haven't found him denouncing the claims by Mike Adams or Ana Maria Mihalcea anywhere. [https://x.com/search?q=from%3Ar_hirschman+%28mike+adams+OR+mihalcea%29&f=live]
In 2024 a large number of Twitter accounts posted a clip of a video where Andrew Zywiec described mass spec results of the calamari clots, and he also said that the clots had a high level of tin and sulphur: [https://fixupx.com/SenseReceptor/status/1811847665573068883]
However in the video Zywiec was just talking about the same results that have been presented by Greg Harrison and Tom Haviland, so I don't know if Zywiec had personally analyzed the clots or if he just reported on the resuls of analysis done by other people.
Zywiec was listed as a member of the "scientific research and advisory team" of An Unholy Triad. Wayne Crouch wrote "I personally know and work with @AndrewZywiecMD he is a member of our scientific research team". [https://x.com/WayneC50256258/status/1872576670034792737] Andrew Zywiec posted images of Greg et al.'s peptide mapping results and wrote "this is my teams actual research in progress". [https://x.com/AndrewZywiecMD/status/1861089117779403240]
Zywiec's videos has been posted by a lot of accounts that promote Miles Guo (which are probably bots even though some of them might be manually ran accounts): [https://x.com/search?q=andrew%20zywiec%20clots%20-andrewzywiecmd&f=live]
According to various people, the white fibrous clots contain the following material or structures:
The clots are like a mirror where people can see their pet topic, so Christie Laura Grace says the clots are caused by LNPs and Geoffrey Norman Pain says the clots are caused by endotoxin.
In November 2022 Jane Ruby did an interview with the counterbioterrorism expert Tau Braun, who claimed that COVID vaccines contained nanobots delivered by graphene oxide, and the calamari clots consisted of tissue that was programmed to grow snake venom glands by the nanobots. The description of the interview said: "On today's Dr. Jane Ruby Show, Dr. Jane interviews Counter-bioterrorism expert Dr. Tau Braun who explains that self-replicating nanoparticles in the C19 shots are programmed to grow venom ducts inside the human body. His theory is that the jabbed are growing live venom gland cells and other animal structures. Dr. Jane shows you the DOJ's research using cone snail venom to make huge amounts of deadly synthetic conotoxins. They say that deep ocean cone snail venom is a serious threat to humans who never dive that deep!" [https://stewpeters.com/video/2022/11/the-jabbed-are-growing-animal-venom-glands-and-ducts/]
Tau Braun said that people were wondering if COVID vaccines contain snake venom or if they contain graphene oxide, but he said they contain both because the graphene oxide acts as a delivery mechanism for the snake venom. At time 13:18, he said: "How do you get venom into the body and how do you keep it stable? You add graphene oxide."
At time 40:33, Tau Braun said that the calamari clots consist of tissue which contains snake venom ducts: "Those monstrous clot-looking things are literally tissue that has grown a duct - and specialized ducts - the closest match I found to these fibrotic clots today is the chameleon tongue - it's the long, very very - extremely - it has what's called the tensile strength, it has elasticity to it. But it's extremely strong. Cause it has to whip out like a whip and it has to come back in, and so it has to have expansion at rapid speed, and it has to be able to go back. So it's like elastic."
At time 17:40, Tau Braun said that if there is a species of snake that eats rodents, then the snake won't produce venom which affects amphibians but only venom which affects rodents, and in the same way the snake venom in the COVID vaccines was designed to not affect Aryans because the COVID vaccines are a race-specific bioweapon that was created by the Fourth Reich: "So why are certain people totally fine from this? I'm gonna tell you that this was built by the Fourth Reich, and I'm gonna tell you that Aryans are not having a problem with this vaccine. I'm gonna tell you that you can stick this into an Aryan over and over. And what I mean by Aryan? I mean people that originally came from Viking heritage, Germanic heritage, and that basically you can go and look at those principles of what Nazis believe the superior race to be. And I'm gonna tell you this weapon was not built for them." Tau Braun also said that the Aryans were planning to kill off nine tenths of humanity.
Tau Braun's bio says that he is a "U.S. National Counterterrorism & EMS Advisor and Trainer" and that he has been a speaker at a bunch of emergency management conferences. [https://www.drtaubraun.com/about]
In September 2021 Carrie Madej started to say that COVID vaccines contained eggs of transgenic parasites of the species Hydra vulgaris. In 2021 before the story about the calamari clots had been rolled out, Carrie Madej told Stew Peters that vaccinated people were growing hydra clots: [https://ambassadorlove.blog/2021/11/01/transgenic-hydras-parasites-a-biological-weapons-system-for-rapid-human-cloning/]
Carrie Madej told Stew: "Let's just look at these water parasites. These things have the potential to grow, and be innumerable, right. If you're growing things, it has the potential to clog your arteries, it can clog capillaries, it can clog lymphatics. So we see blood clotting happening, and plus the body's response to having an infection, or a parasitic invasion, right, would be an inflammatory response, would be to have inflammation, which perhaps clotting an area." [https://www.bitchute.com/video/CU7FTZwr54yP/, time 12:12] And then the video cut off to the photo of the clot above, and Madej said: "So, they're pulling clots sometimes out too that's almost as big as my hand, you know, has finger-like extensions coming from let's say the heart."
However the hydra clot was actually a clot from the lungs of a heart failure patient from 2018: [https://empr.com/home/news/heart-failure-patient-coughs-up-bronchial-tree-shaped-blood-clot/]
Before the story about the new type of white clots was rolled out in January 2022, in 2021 La Quinta Columna were saying that vaccinated women had black period blood that contained black clots (because graphene is black, and at the time La Quinta Columna were primarily famous for their claim that vaccines contained graphene oxide): [https://www.bitchute.com/video/WGjJ2rgw14N9/]
In 2021 La Quinta Columna published videos about how vaccinated parents had "pandemic babies" who appeared to have completely or almost completely black eyes, and the babies were also developing rapidly so that they were able to walk when they were 3 months old or crawl when they were 2 weeks old: [https://www.orwell.city/2021/09/black-eyed-babies.html]
In 2021 Resistance GB did one interview with John O'Looney and another interview with a British funeral director named Wesley who seems to have later been forgotten (even though I don't know if he was actually a funeral director or if he was just an actor playing a role):
Wesley said that around the time when people in younger age groups got vaccinated, he had about 2 to 3 times the normal number of funerals, and all of them were people in their 40s or younger, there were no longer any elderly people dying because the elderly people who were going to die in the next year or year and half had already died when the vaccines were rolled out to older age groups. He said: "So this year, as the vaccinations have gone on, I've seen trends through the age groups. Obviously, it's not marked down that they're vaccinated. But to have the most funerals that you've ever done in two weeks, and they're all aged 30, 40, no older. […] That's what I saw earlier in the year, when that age group got vaccinated. […] Well you always usually deal with all different age groups, but as I was saying, the elderly that were probably gonna go in the next year - or year and a half or whatever - they've already gone. So, there's a big gap there. So we weren't having those deaths anymore. And, with younger people, they're now vaccinated, and I had about 12 in one go. […] We normally have about 4 or 5 funerals going, not 12 - 11 or 12 - and not all of that age group. There would be old people in there. And then now it's quiet. And what I've seen is a lot of newborn babies in the fridges in the mortuaries." [https://odysee.com/@ResistanceGB/funeral-director-babies, time 1:16; transcript at https://dailytelegraph.co.nz/news/uk-funeral-director-there-are-10-times-more-dead-babies/]
It's not clear if he meant that all people who died were in their 40s but not older or that all people were aged 40 but not older (or if by all people he meant nearly all people). But in any case his anecdotal statistics are inconsistent with actual mortality statistics in England, where in May to June 2021 when the highest number of people in their 30s and 40s got vaccinated, only about 5% of all deaths were in ages 0-49: [https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/adhocs/1343dailydeathsbydateofoccurrence1stjune2014to31stmay2023bysingleyearofageengland]
t=setDT(readxl::read_excel("dailydeaths2014to2023england.xlsx",sheet=4,range="A6:CP3293")) a=t[Year==2021&Month%in%5:6,.(age=0:90,dead=colSums(.SD)),.SDcols=4:94] a[,sum(dead[age<50])/sum(dead)] # 0.05494073
At time 4:16 when Wesley was asked what causes of death he saw written down on the death certificates, he answered: "There's a lot of myocarditis, myocardial infarction - it's all blood, heart-based - pneumonia - but COVID, I've only had one this year. One COVID death written down since January." But according to Nomis about 12% of all deaths in England in 2021 had the underlying cause COVID: [https://www.nomisweb.co.uk/query/161.1/advanced.aspx]
A common trope among alt media morticians is that they have a dramatic story to tell about dead babies. At time 2:57 Wesley also said there were about ten times more babies dying than normally, so there was no more room in the fridge for babies so the dead babies had to be placed in an adult fridge:
Interviewer: So, do you want to talk about the number of newborn babies that you've seen in the morgue?
Wesley: Oh, they're really high. They're up at about 13 in one hospital.
Interviewer: And how many would they usually have?
Wesley: They have fridges that will hold about 6 to 10 maximum. And they're never normally full. But now, they're on in the adult section. Interviewer: So, there's about maybe ten times the rate, wouldn't you say?
Wesley: Yeah. Yeah. And obviously they're either miscarried or full-term stillbirths, but not a lot's been said about it.
However based on this plot, the stillbirth rate in England and Wales was not particularly high in 2021: [https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/livebirths/bulletins/birthsummarytablesenglandandwales/2022]
Wesley didn't say anything about a new type of white clots during his interview. I only found one other video by Wesley, which was a short video from December 2021 where he said that the pandemic was fake, but he didn't mention a new type of white clots in the other video either. [https://x.com/JournoJones05/status/1473397089128361988]
I found only a few tweets about Wesley. [https://x.com/search?q=funeral+director+wesley&f=live] In one tweet John O'Looney wrote "Meet Wesley and i have spoken to him to verify he is who he says he is, hes a good honest guy." [https://x.com/OlooneyJohn/status/1765146515662660003] Two other tweets were posted by an accounts that promote Miles Guo: [https://x.com/wiGuWZf1EpnmDod/status/1457663137344212995, https://x.com/Paige56Japan/status/1457662661710082052]
When I searched Twitter for defense medical epidemiology database until:2022-1-30
, the earliest tweet I found which related to the data presented by Tom Renz was posted by Daniel Horowitz, who posted a link to his article where he interviewed Renz: [https://x.com/RMConservative/status/1486357637310603268]
The original article by Horowitz was deleted and it's not available at the Wayback Machine, but it was copied here: https://catholiccitizens.org/views/98324/horowitz-whistleblowers-share-dod-medical-data-that-blows-vaccine-safety-debate-wide-open/. Many other early tweets about the DMED data also linked to the article by Horowitz.
I believe Hirschmann was also the third person who interviewed Hirschman after Jane Ruby and Steve Kirsch. [https://podcasts.apple.com/us/podcast/are-the-vaccines-causing-solid-frankenstein-blood/id1065050908?i=1000551322493]
In April 2022 Horowitz also tweeted this video of clots from he said he received from an unnamed embalmer, but I didn't find the video posted anywhere else earlier: [https://x.com/RMConservative/status/1519475175527526401]
In July 2022 Daniel Horowitz also posted a Gettr post which said "These are clots that an Indiana embalmer pulled out of dead bodies recently." [https://gettr.com/post/p1hroyce14c] It's possible the photo came from Wallace Hooker who is from Indiana, but I believe in July 2022 Hooker had not yet appeared anywhere in alt media. When I searched for the image on reverse image search engines, I didn't find it posted anywhere else earlier, and I also didn't find it posted on Twitter when I searched for indiana embalmer until:2022-7-10
:
The DMED whistleblower Theresa Long is the person who is supposed to have randomly discovered Richard Hirschman by chance and connected him with Jane Ruby. Hirschman said: "And then it happened that one of the whistleblowers - the DOD whistleblower, Dr. Theresa Long - just so happened to be attending a funeral service at one of the funeral homes that I do enbalming. And they got on this topic after the service - her and one of the funeral directors - and the funeral directors says, 'I know somebody you need to talk to.' He put me in contact with her. I shared with her the images. And she was shocked because she was hearing things from soldiers that were having blood clots in their arms that were highly unusual. And so she ended up getting me in contact with Dr. Jane Ruby." [https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html?start=328] What makes Hirschman's chance encounter with Theresa Long even more suspicious is that Hirschman said that John O'Looney was one of his heroes, and he first saw a video by O'Looney around September, October, or November of 2021, which was before he met with Theresa Long by chance. [https://rumble.com/vucdbi-embalmer-richard-hirschman-reveals-novel-clotting-in-65-of-cases.html?start=1850, https://rumble.com/v4buruf-truth-science-and-spirt-episode-6-rubbery-clots-conversation-with-richard-h.html?start=227]
In 2024 Greg Hunter told Theresa Long that he believes that COVID vaccines change the DNA of vaccinated people. Then Theresa Long answered: "I believe God's name is written on your DNA. The name of Yahweh. And Yahweh corresponds to the numbers 10-5-6-5, and that is the spacing of the base pairs in your DNA. And the 10th base pair, the 5th base pair, the 6th base pair, and then the 5th again, that's Yahweh." [https://rumble.com/v5hysr1-fact-covid-vax-kills-and-injures-according-to-lt.-col.-dr.-theresa-long-md.html?start=2642] Then Hunter said: "And this does change that sequence. This does change that code." And Long said: "There is there is more and more research showing that it does change your DNA. Yeah that would be the basis for religious exemption."
Todd Callender is a lawyer who worked with the DMED whistleblowers, and he was also listed in the credits of An Unholy Triad as having provided "legal advice and support".
In November 2023 Callender told Jane Ruby that calamari clots are 5G antennas: [https://rumble.com/v3yowh4-bombshell-proof-embalmer-clots-are-5g-controlled-human-antennas.html]
Jane Ruby said this about the clots: "But the point of the story is, Mike Adams did an incredible analysis when he magnified at hundreds and hundreds and hundreds of times - he did see what looked like circuitry. We still don't know 100% what the chemical composition is, but we know that it was all metallic, and very rare metals that are not usually found in humans. So I want to put that together with our discussion, not to throw in just for the fun of it, but so that we can start to tie it together with what you have found." [13:10] Then Todd Callender said that he independently came to the same conclusion as Mike Adams, and the clots did in fact contain metals, and the metals acted as 5G antennas. And he said that ultimately the clots turned humans into cloud computing nodes that had interoperability with the 5G system.
Later Todd Callender said: "And, so this has been further corroborated by Dr. Theresa Long. She's one of my affiants. You and her both have given expert testimony in my case where we asked - we filed it in the US Supreme Court, by the way, and - and what she came to observe after we started - you know, kind drilling down on this - is that she noticed that a lot of the people on her post and other places had these weird rings on the top of their heads. And as we started to dig into this, the, the hackers were - or the paper about the hackers was saying - that because these people were being tracked too much - because the hackers were tracking too many people - it had a deleterious effect on people's bodies, as seen by, as indicated by the top of their heads, the GPS causing irritation." [23:26] And Callender said: "It's the crown, the crown of the head is how she describes this. They bought us coronavirus. Corona is Spanish or Latin for crown. And so it makes perfect sense." And Jane Ruby asked: "And Dr. Long is seeing this in military patients that she's examining?" And Callender answered yes.
Often electomagnetic waves are depicted as concentric rings or arcs, like in symbols that depict Wi-Fi or cell towers, even though it doesn't actually mean that the intensity of the electromagnetic waves relative to the midpoint of the receiving or transmitting device would form rings that would have some stronger layers and some weaker layers.
And anyway the way GPS works is that satellites transmit a GPS signal that is picked up by a passive receiver, so people are exposed to the signal from GPS satellites even if there's no GPS receiver inside their body to pick up the signal. And even if there was a GPS receiver inside the head, the part of the head directly above the receiver would be exposed to a similar amount of electromagnetic radiation from GPS satellites as the rest of the head.
In an interview with Lee Merritt, Todd Callender said that the calamari clots are amyloid antennas: "And I talked to the guy that was yanking these out of bodies, by the way, and others who tested them. And they're amyloid! And so, we went back and we figured out what is it, and they're actually the antenna part of our bodies that are hooked into the 5G network, bind to our wireless body area network. They're amyloid antennas! That's what they are! And as our body gets transformed into this synthetic version, you know, some blood flow goes past, some people surviving, some people don't." [https://rumble.com/v45696i-dr.-merritt-and-attorney-todd-calendar-on-the-enemy-within.html?start=2417] Then Lee Merritt asked: "So you don't think that's the hydra in that white stuff?" And Callender answered: "I think it's for sure. […] But sure, I think that hydras have actually been found. And those creatures, they're not regular biology either as I understand. They're effectively an alien species."
In April 2025 the calamari clots were back in the news, and articles about the findings of Tom Haviland and Greg Harrison were published by the fake news sites The People's Voice, Slay News, and Natural News. [https://thepeoplesvoice.tv/embalmers-uncover-rubbery-clots-in-27-of-mrna-vaccinated-corpses-worldwide-over-past-year/, https://slaynews.com/news/embalmers-issue-chilling-warning-fibrous-clots-found-27-covid-vaxxed-corpses/, https://naturalnews.com/2025-04-06-vaccine-clots-exhibit-prion-like-seeding-activity.html]
The article by The People's Voice also featured this video titled "Japan Warns Hearts of 6 Billion Vaxxxed Set to Explode in Global Catastrophe":
The author of the article by Slay News was Frank Bergman. His portrait picture seem to have been generated by an interface to StyleGAN like thispersondoesnotexist.com: [https://science.feedback.org/slay-news-frank-bergman-not-real-we-investigate-whos-misinformation-site/]
Around the same time Expose News also republished an article by Tom Haviland that was originally published in the Clotastrophe blog, and the article was promoted by Sense Receptor: [https://x.com/toobaffled/status/1907928501862490225]
Around the same time videos of Greg Harrison and Tom Haviland were also posted by Sense Receptor and Jim Ferguson: [https://x.com/SenseReceptor/status/1909741957942771987, https://x.com/JimFergusonUK/status/1909894887287185618]
Sense Receptor, toobaffled, and Jim Ferguson all post the same type of video clips from controlled alt media, and they all promote fake news sites like The People's Voice, Slay News, and Expose News.
All three accounts are also promoted by the same type of bot accounts. In 2024 I scraped the reposts of about 80 accounts that I suspected to be bots that promoted content from the controlled alt media. When I picked COVID-related accounts reposted by the bots and I divided the number of reposts by the number of followers of each account, SenseReceptor ranked 5th highest, toobaffled ranked 7th highest, and JimFergusonUK ranked 15th highest: [bot2.html#Reposts_by_bots_compared_to_number_of_followers]
reposts followers ratio user comment 69 19200 0.0035938 mariusknulst portrays a Norwegian lady but might not be a real person 34 13000 0.0026154 McCulloughFund McCullough Foundation 134 57400 0.0023345 sophiadahl1 another account of mariusknulst; promotes flat earth and Stew ops 360 186700 0.0019282 MakisMD William Makis; was on TWC Canada's medical board 41 21400 0.0019159 SenseReceptor SPN text version like Expose News and Lioness of Judah Ministries 627 363400 0.0017254 BGatesIsaPyscho Concerned Citizen; account with most community notes 139 87100 0.0015959 toobaffled Sudden and Unexpected 92 78100 0.0011780 _aussie17 former pharma executive; promoted Barry Young early 483 482200 0.0010017 wideawake_media UK blog 130 132700 0.0009797 CraigKellyPHON Australian politician 22 26300 0.0008365 Stuckelberger Astrid Stuckelberger; pushes Stew ops like hydras 35 41900 0.0008353 TheSeeker268 only reposted by one outlier bot 160 195700 0.0008176 newstart_2024 Camus; often reposted by Alex Jones 351 439800 0.0007981 liz_churchill10 posts many video clips and does X spaces 174 224000 0.0007768 JimFergusonUK UK politician who has a podcast focused on COVID 104 136700 0.0007608 bambkb display name "Kevin - We the People" 164 232000 0.0007069 CartlandDavid bio says account is managed by PR team 125 180700 0.0006918 robinmonotti ran a Telegram channel with Mike Yeadon 29 49100 0.0005906 COVIDSelect Subcommittee on the Coronavirus Pandemic 374 694300 0.0005387 PeterSweden7 Peter Immanuelsen
The article about the clots by Slay News mentioned Kevin McCairn: [https://slaynews.com/news/embalmers-issue-chilling-warning-fibrous-clots-found-27-covid-vaxxed-corpses/]
Harrison asked Richard Hirschman to send multiple samples of the white fibrous clots to Dr. Kevin McCairn, a distinguished neuroscientist in Japan.
Dr. McCairn has spent his career studying the effects of amyloid proteins on patients suffering from Alzheimer's, Parkinson's disease, and dementia.
Harrison asked Dr. McCairn to check the white fibrous clot samples for the presence of prions.
First, Dr. McCairn performed Raman spectroscopy, which confirmed the researchers' worst fears about the clots.
Then, in March 2025, Dr. McCairn performed a Real-Time Quaking-Induced Conversion Test (RT-QuIC Test) on three different white fibrous clot samples to determine the presence of prion-like seeding activity.
All three sample clots tested "positive" for prion-like seeding activity.
In May 2024 The People's Voice also published an article about an article about McCairn titled "Neuroscientist: 'Contagious' Prions From Covid Jabs Are 'Transfecting' the Unvaccinated". [https://thepeoplesvoice.tv/neuroscientist-contagious-prions-from-covid-jabs-are-transfecting-the-unvaccinated/] The article said:
According to Dr. McCairn, contagious prions released by Covid jabs behind the explosion of disease around the world and explain the mechanism for phenomena including "silent hypoxia", the formation of white fibrous clots, the sudden deaths of athletes, turbo CJD, turbo cancer, amyloidosis, and the explosion of neurological diseases.
[…]
As a result of the prions being released into the environment, we now have a situation where these lab-designed toxins are being absorbed by living things, including the unvaccinated population.
As a consequence, disease is exploding around the world. Dr. Cairns explains that bioaccumlating misfolded proteins are cascading and forming a chain reaction.
In the previous section where the accounts are sorted by the ratio of reposts by suspected bots relative to followers, the account mariusknulst ranks first and sophiadahl1 ranks third. They are both portrayed as accounts of the same Norwegian lady, but I suspect they are actually bots. [bot2.html#sophiadahl1_and_mariusknulst]
sophiadahl1 often retweets random tweets in languages like Turkish and Portuguese, which Norwegians is unlikely to understand:
Later when I checked the most recent tweets by SophiaDahl1 again, within the 10 hours it had retweeted a tweet about flat earth, it had retweeted tweets in Turkish, German, Hindi, and Chinese, and it had retweeted accounts which quoted one of its tweets and commented on the tweet in Turkish, Bosnian, Finnish, Swedish, and Dutch, and it had retweeted an AI-generated image of Elon Musk that was posted by an Elon Musk fan account:
The image below shows two variants of the same tweet that were posted by sophiadahl1 about one month apart. The tweets look like they might be generated by AI based on some template so that it humanized the text by introducing a certain number of errors to the template, so that it doesn't look like grammatically perfect text that was generated by AI but it looks like text that was written by a crazy person. The text I added in yellow shows that the older tweet included some errors that were missing from the newer tweet, but the newer tweet also included many errors that were missing from the older tweet (which wouldn't make sense if the new tweet was written by a human who edited the old tweet to fix errors): [https://x.com/sophiadahl1/status/1808009492262510961, https://x.com/sophiadahl1/status/1822181811012722858]
Later when sophiadahl1 posted a similar tweet yet again, there were more errors introduced to the tweet that were missing from both earlier versions, like that the word "fuellmich" was written in lowercase, and there were two superfluous spaces before punctuation characters. [https://x.com/sophiadahl1/status/1910948406752665726]
sophiadahl1 also promotes flat earth:
Here sophiadahl1 promoted a video about the clots by Peak Prosperity, but similar tweets had been posted earlier by accounts called JaneBond (backup) and Project TABS:
This tweet about the clots by sophiadahl1 had also been posted earlier by JaneBond (backup)
Below sophiadahl1 posted a video about calamari clots by Kla.TV, which is conspiracy video site that is ran by a Swiss cult that has connections to Scientology. Similar tweets had been posted by JaneBond (backup), and by Sudden and Unexpected which is reposted by the same type of bots that also repost sophiadahl1: [https://x.com/sophiadahl1/status/1846357133161316535]
I found a Vietnamese bot called Dungpikachu that mainly promoted a cryptocurrency called Pi. It often also promoted Elon Musk and Trump, and it also posted about Q. It didn't post that much about Western conspiracy topics, but one time it still quoted a photo of calamari clots, which was posted by another Vietnamese bot which promoted the cryptocurrency Pi, and which also promoted Trump, Elon Musk, and Q: [https://x.com/Dungpikachu, https://x.com/SmolfSmolf7]
Twitter is full of accounts that promote Miles Guo's cult in various languages and that also promote content from the western controlled alternative media. However it's not that well known that there's also similar bots that promote the Raelian UFO cult and that promote the same type of phony conspiracy content. One of them called NobbyRaelian posts in Japanese. It reposts a similar set of accounts that are also posted by other bots that promote content from the controlled alt media, including BRICS News, illuminatibot, Concerned Citizen, Stew Peters, Mario Nawfal, Epoch Times, healthbot, Vigilant Fox, KanekoaTheGreat, Jim Ferguson, and Wide Awake Media:
The Raelian bot NobbyRaelian posted this video where Mike Adams said that there was a wire coming out of one of Hirschman's clots, and the wire was made out of repeating patterns that looked like reptilian scales: [https://x.com/NobbyRaelian/status/1908306733124247741]
The same Raelian bot also posted many videos of Bryan Ardis, who was the star of the Watch the Water movie which was the prequel to Died Suddenly:
The Japanese Raelian bot also posted this video that promoted The Wellness Company's Spike Detox product:
A bot called Ellenng2013 promotes western conspiracy content in Chinese. It doesn't promote Miles Guo's cult, but it still reposts the same type of accounts that are reposted by the Guo bots and Raelian bots, like for example Thekeksociety, bambkb, WideAwakeMedia, thehealthb0t, iluminatibot, ShadowOfEzra, KanekoaTheGreat, BGatesIsaPsycho, and redpillb0t:
Ellenng2013 also promotes flat earth:
And it posted this tweet where Tom Haviland showed calamari clots:
Ellenng2013 also promoted TWC's Spike Detox product:
The account of the leader of Raelianism only posts links and retweets, so it might be either a bot or a human-bot hybrid. It also retweets a similar set of accounts that are retweeted by bots, including accounts that promote Raelianism that are clearly bots. The emblem of Raelianism features a Star of David and a swastika which are also featured in the emblem of the Theosophical Society, but Rael and other Raelian accounts appear to be fans of Assange who grew up in a neo-Theosophical cult. Maitreya Rael also retweeted videos of kalamari clots that were posted by thehealthb0t and DiedSuddenly_: [https://sars2.net/bot2.html#Maitreya_Rael]
One time Maitreya Rael posted a link to an article by Vigilant News which said "Check up this awesome contentDr. Peter McCullough Gives Expert Testimony on the Safety and Efficacy of the COVID-19 Vaccines" (which unusually said "check up" instead of "check out", and the words "content" and "Dr." were joined together):
When I searched for tweets that matched the text "Check up this awesome contentDr.", I found bots that had posted links to several other articles about McCullough at Vigilant News. McCullough is TWC's chief scientific officer, and Vigilant News Network was founded by TWC's cofounder Foster Coulson: [https://x.com/search?q=%22check+up+this+awesome+contentdr.%22&f=live]
This tweet says in Chinese that "embalmer Richard Hirschman and other collaborating researchers (including retired organic chemist Dr. Greg Harrison) analyzed the composition of these blood clots. They found that these blood clots contained a class of abnormally folded starch-like proteins called prions". [https://x.com/m16tri/status/1911680094399316107] It even included an image by UveBeenNudged who is one of Kevin McCairn's meme makers:
The tweet was posted by an account that posts Western MAGAboomer content in Chinese, even though it doesn't promote Miles Guo. I'm not sure if the account is a bot or not. Its banner image is an image of Elon Musk:
Many of the earliest tweets by the account were replies to Joe Biden that were written in English: [https://x.com/search?q=from%3Am16tri+until%3A2021-5-1&f=live]
The same account has also posted a lot of tweets about Q: [https://x.com/search?q=from%3Am16tri%20%23q&f=live]
A video of Kevin McCairn posted by SenseReceptor was quoted by an account called lex_is_lex_ that posts in Chinese: [https://x.com/lex_is_lex_/status/1911825548373869052]
The most recent tweets of the Chinese account also included quote tweets of NicHulscher, _aussie17, vegastarr, iluminatibot, toobaffled, VigilantFox, liz_churchill10, P_McCulloughMD, redpillb0t, ShadowofEzra, DiedSuddenly_, BGatesIsaPyscho, and newstart_2024 (which are all promoted by the same type of bots that promote SenseReceptor).
If you scroll through the timelines of enough of these accounts, it's uncanny how they always repost a similar set of accounts. But there's other popular accounts that almost never get reposted by these accounts. I think there's some kind of a whitelist of accounts which are designated to be artificially amplified by bots.
The account lex_is_lex_ also quoted this tweet which claimed that Jane Ruby's sample of chemtrail fog contained a Morgellons fiber: [https://x.com/lex_is_lex_/status/1907591417758638446]
lex_is_lex_ also quoted a video posted by thehealthb0t about ball bearings self-assembling in castor oil. When I searched for the text of the tweet in double quotes, I found that a similar tweet had been posted by ProjectTabs (which I earlier found had posted a similar tweet about the calamari clots as the flat earther bot sophiadahl1):
I scraped the timeline of lex_is_lex_ up to the point when the infinite scrolling stopped loading more tweets. These were the accounts it had retweeted or quote tweeted at least 5 times:
53 toobaffled # Sudden and Unexpected 16 iluminatibot 16 NicHulscher # foundation administrator of McCullough Foundation 15 RedpillDrifter 15 BGatesIsaPyscho # Concerned Citizen (account with most community notes) 13 maximumpain333 11 vegastarr 11 redpillb0t 11 Uncommonsince76 11 ShadowofEzra 10 lex_is_lex_ 10 WallStreetApes 9 VanceE 9 SenseReceptor 9 DavidWolfe # flat earther health guru whose tweets are identcial to bots 8 VictorFromDE 7 thehealthb0t 7 liz_churchill10 7 Mind_Essentials 7 Maddi0578PG 7 Lovandfear 6 DrSuzanneH7 6 AmurakaHidden 5 theamuzed1 5 kevinnbass 5 _APWK_ 5 RealDrJaneRuby 5 LucasGageX 5 HealthRanger 5 DiedSuddenly_
Philip McMillan offers a free online course about the calamari clots, which is basically just a website where you have to enter an email address in order to see the content. The course features a section titled "Observations from Endovascular Surgeon", which consists of a 5-page document that looks like a letter from a surgeon to McMillan: [https://vejonhealth.learnworlds.com/course/embalmers-clots-composition-and-cause, f/mcmillan_letter_from_endovascular_surgeon.txt]
The surgeon wrote that they had not seen calamari clots in their lab: "Anyway, I was looking for examples of what I heard your guy talking about. We also did a lot of vein patients but, once again, though I was watching out for these cases, I never saw/heard about any of our patients (and we had a very active Vein Practice, at least prior to Covid) having extensive venous blockages like your witness produced. DVT's are not that uncommon in a very busy vein ablation practice. We were doing upwards of 30-45 venous ablations a week, on average, prior to Covid. Covid really did a number on us, like other clinics, especially when people started locking down. But the DVT's that we experienced post mRNA Vaccine deployment, and once again, the vast majority of our patients were mRNA vaccinated, their clots were easily managed and fully resolved with a course of anticoagulative treatment, usually within 2-3 weeks. There had to be one in there, but maybe we just didn't identify it."
The surgeon also wrote: "Without understanding the timing of onset of theses white, fibrous clots, when they began forming, either weeks/months prior to their event or just days before their event, I don't know how we could have missed these blockages during the procedures. Moreover, all of our patients, within a week or two prior to a venous ablation or arterial intervention, had a full vascular ultrasound study that would certainly have demonstrated these obvious tissue amalgamations, even the smaller ones. Most certainly the larger ones I've witnessed on your podcasts with your whistleblowers and your embalmers. No way, with our technologist talents, could these growths have been missed."
The surgeon speculated that the reason they weren't seeing the clots may have been if the clots formed soon before death: "The only real conclusions I can come to, during the entire time of witnessing our practice's patient demographics and the procedures we performed on them, and many of them were repeat customers, sometimes requiring multiple repeat annual interventions, is that these blood clots, fibrous or jelly, must happen rather abruptly, because our patients typically receive follow up vascular Ultrasonography 2-3 times per year, and we never noticed these large blockages that would certainly, without a doubt be able to visualized. Our equipment was the best. Our very best techs would have found them too. My surgeon partner looked at every single study personally. Nothing out of the ordinary, anyway. So this makes me hypothesize that these structures must form very quickly in an acute way, resulting in the patient needing an emergency trip to the hospital, or dying and going to the embalmers." However for example Tom Haviland has said that the reason why morticians say they only started seeing the clots in mid-2021 might be if the clots take about half a year to form. And Nicky Rupright King said she didn't start seeing the clots until 2022, and she suggested the clots might take more than a year to reach their full size. And anyway if the clots only take days to form, then why weren't embalmers already seeing the clots in January 2021?
The surgeon who sent the letter to McMillan wrote: "Unlike the clinic of the Whistleblower in your podcast, that was a hospital that did every body part, from the brain to the heart to the lower extremities, we were limited to doing pelvic and lower extremity endovascular atherectomies and angioplasties. Of course we did some stenting, when necessary." But I don't think that would explain why people in his lab were not seeing any calamari clots. A more likely explanation is that the clots are a hoax, and McMillan's cath lab whistleblower was lying.
I didn't find the surgeon's letter published anywhere else. I also haven't heard McMillan mention the letter anywhere, and I didn't find it published on his blog, which might be because the letter conflicts with the narrative about the clots he is trying to present to his audience.
I found footage that looked like original video footage of the following people in the Died Suddenly movie (sorted by the time of the first appearance): [https://rumble.com/v21zezm-the-died-suddenly-documentary.html]
Time | Person |
---|---|
6:11 | Chad Whisnat (funeral director) |
8:16 | Richard Hirschman (embalmer) |
10:30 | anonymous male funeral director |
10:44 | John O'Looney (UK funeral director) |
11:26 | Brenton Faithful (New Zealand embalmer) |
11:33 | Anna Foster (embalmer) |
13:15 | Wallace Hooker (embalmer) |
16:01 | Nicky Rupright King (embalmer) |
16:26 | anonymous female who talked about embalming |
20:52 | Theresa Long (DMED whistleblower) |
23:22 | Pete Chambers (DMED whistleblower) |
32:20 | Ryan Cole |
33:57 | Steve Kirsch |
37:48 | unnamed family pediatrician |
Chad Whisnat was featured prominently in the Died Suddenly movie, but I found little information about him, and I didn't find any place he had appeared in alt media apart from the Died Suddenly movie.
The Died Suddenly movie featured about 7 minutes of footage of Steve Kirsch, which was the second most footage of any person after Hirschman, even though Kirsch didn't even talk about the clots in the movie. Kirsch seems to be connected to the story about the clots in multiple ways, because I believe he was the second person after Jane Ruby who interviewed Richard Hirschman. And he was the first person who interviewed Anna Foster and Cary Watkins, who I think were the next two people after Hirschman who claimed they had seen the calamari clots. And the results of Tom Haviland's surveys were also published by Kirsch.
About 7 minutes of the Died Suddenly movie consisted of a segment where Theresa Long and Pete Chambers discussed the DMED data, even though it had little to do with the clots. However there also seem to be several other connections between the story about the DMED data and the story about the clots:
Kirsch has also published several Substack posts about the DMED data, and he did interviews with the DMED whistleblowers. And an indirect connection between Kirsch and the DMED data is that Mathew Crawford wrote that "I was asked by Robert Malone to be the statistician who would examine the Defense Medical Epidemiological Database (DMED)". [https://roundingtheearth.substack.com/p/was-the-dmed-psyop-a-british-intelligence] But Malone appeared on the Weinstein podcast together with Kirsch, and Malone used to be listed as a member of VSRF. [http://web.archive.org/web/20230508182655/https://www.vacsafety.org/about-us/] Kirsch's PR guru Trevor Fitzgibbon may have been the person who got Malone on Rogan, but he said that he represented Malone under the umbrella of VSRF. [yt.html#Trevor_Fitzgibbon_worked_with_Schoenbergers_ShadowBox_company]
I haven't seen anyone on mainstream media claim that they started to see a new type of white clots in 2021.
In February 2024 Aussie17 posted a video with the title "Kaboom! Renowned Neurologist and Thai Red Cross Emerging Infectious Diseases Health Science Centre Lead Prof. Dr. Thiravat Hemachudha Exposes Vaccine-Linked White Clots on Thailand's Popular TV3". [https://www.aussie17.com/p/kaboom-renowned-neurologist-and-thai] So I thought maybe there's now finally a doctor who claims to have seen white clots on mainstream media.
However the Thai neurologist indicated that the source of his information was John Campbell's YouTube channel, and he didn't say he or anyone he knows would've personally having seen the clots:
A user on Twitter said that the clots in the thumbnail of this video were "calamari-like clotting", even though the clots were /inside a surgery drain tube: [https://x.com/CheweyLife/status/1914528829890068632]
But an MD user replied: "Uhm, yeah. After week of surgery drainage, white clotting in them is not unusual at all. After all its the fibrin rich wound secretions drained through plastic tubes. Usually you pull them, before they clot. Its totally different to havin white clots build-up inside blood vessels". [https://x.com/53v3n0fn1n3/status/1914690994529849616] The user also wrote: "Clotting cascades are triggered on the wounds surface. Clotting in these tubes starts when the suction doesn't work properly. Some get them, some don't. Lymphadenectomy can leave a huge wound inside, so drain is left as long as secretion keeps going, weighed with inf. risk."
Richard Hirschman also shared the same video by the lady who showed the clots in a surgery drain tube, and he wrote: "The clots she shows look very similar to the ones that I have been seeing during the embalming process, the difference is she's alive and those who I embalm are not. If the clots are the same, they can't just be postmortem. There was a vascular surgeon whistleblower who spoke with Dr Philip McMillan about the same type of clots that he has been seeing. How does a vascular surgeon remove postmortem clots during the surgery on a living person?" [https://x.com/r_hirschman/status/1914458661021475307]
This was one of the photos that was shown by the lady in the video: [https://rumble.com/v6scfap-melanies-health-destroyed-after-4-mrna-shots-auto-immune-disease-turbo-canc.html]
In March 2024 NZDSOS tweeted this photo of "rubbery white structures being discharged through a surgical wound drain site" (but it may have just showed regular clots in a surgical drain tube): [https://x.com/nzdsos/status/1767386236925387026]
The earliest place where I found the same photo posted was in the blog of NZDSOS, where the photo was not given any source but its caption said "Photo Provided for Use - Copyright Free". [https://nzdsos.com/2024/02/20/rubbery-clots-campbell/] So I guess it's an original photo published by NZDSOS.
I wonder if the calamari clots could somehow be manufactured by just taking real blood and passing it through some kind of a tube? You might also add in extra fibrinogen or other clotting factors, or you might add in some lipopolysaccharide to induce the formation of amyloid fibrin.
ChatGPT said:
Yes, large white fibrin clots can be manufactured by passing blood through a tube, especially under specific conditions that promote clot formation. White clots, which are rich in fibrin and platelets but contain few red blood cells, form more readily in environments that mimic arterial shear stress or involve contact with artificial surfaces. When blood flows through tubing, especially materials like silicone or PVC, it encounters non-biological surfaces that can activate the intrinsic coagulation pathway. The introduction of turbulence, high shear forces, or regions of stasis within the tubing can further encourage clot formation by stimulating platelets and initiating the clotting cascade.
To induce or enhance clot formation, additives such as fibrinogen or clotting factors can be introduced. For example, blood that has been anticoagulated with citrate can be recalcified by adding calcium chloride just before it enters the tubing, thus restoring the ability to clot. Adding thrombin directly can rapidly convert fibrinogen to fibrin, accelerating clot formation. Supplementing with additional fibrinogen can also increase the size or density of the resulting clot. The process may be made even more efficient by introducing tissue factor to trigger the extrinsic pathway and control the timing and location of clot formation.
In order to manufacture clots with the amyloid fibrin observed by Kevin McCairn, perhaps bacterial LPS could be added to the blood to induce misfolding of fibrin, like what was done by Pretorius and Kell, who wrote: "Here, we show that the addition of tiny concentrations (0.2 ng l(-1)) of bacterial LPS to both whole blood and platelet-poor plasma of normal, healthy donors leads to marked changes in the nature of the fibrin fibres so formed, as observed by ultrastructural and fluorescence microscopy (the latter implying that the fibrin is actually in an amyloid β-sheet-rich form that on stoichiometric grounds must occur autocatalytically). They resemble those seen in a number of inflammatory (and also amyloid) diseases, consistent with an involvement of LPS in their aetiology." [https://pmc.ncbi.nlm.nih.gov/articles/PMC5046953/]